SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA28844 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA28844
Domain Number 1 Region: 9-206
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.36e-34
Family Laminin G-like module 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA28844
Sequence length 237
Comment (Caenorhabditis japonica)
Sequence
MARCLEGVCANQGRCIQLWTSIRCDCSWTAYSGDRCQSPATTVRFDGSPSAIFYEYTPAE
RPTSSKDFFVFSFRTTQPSGVLIAIECAADQDYFTIFLREGYLHAHYNLGSRDHKVGYYT
RIVNDGFLHVIKVSRNEANMTIQVDKLPALRYRPKRASDLVLLNMQTRISIGASFNARHL
DERRLLRHRRSTDIFDAYQGEVTGVNVNGLMILDLYENGEPLFSFSFFLPLSQHSSP
Download sequence
Identical sequences CJA28844 281687.CJA28844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]