SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000002489 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000002489
Domain Number 1 Region: 1-118
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.6e-17
Family Laminin G-like module 0.0026
Further Details:      
 
Domain Number 2 Region: 111-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000131
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 152-184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000384
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000002489
Sequence length 226
Comment (Anolis carolinensis)
Sequence
GPAVLRSAKPLELGQWHRATAERLNKDGSLQVDEERPVKRSSPGKSQGLNLRTAMFLGGV
DDALRLPATANISSHFYGCIGEASVSINGKKVDISYSFLESRGISQCVDGSPCDRRPCQH
GGKCLVTGEYEFQCLCQEGYKGERCEVSEVQCRLQRPCLNGGTCRDTTCVCLPGFLGLYC
EHDESRRPFNAEWTPEGSGGNDAPGQYGAYFHDGGYVALPPHTFPR
Download sequence
Identical sequences 28377.ENSACAP00000002489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]