SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000007136 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000007136
Domain Number 1 Region: 293-392
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-35
Family SPRY domain 0.00012
Further Details:      
 
Domain Number 2 Region: 10-79
Classification Level Classification E-value
Superfamily RING/U-box 4.86e-21
Family RING finger domain, C3HC4 0.0084
Further Details:      
 
Domain Number 3 Region: 93-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.29e-16
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000007136
Domain Number - Region: 265-287
Classification Level Classification E-value
Superfamily RING/U-box 0.00544
Family RING finger domain, C3HC4 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000007136
Sequence length 393
Comment (Anolis carolinensis)
Sequence
MASSAAKDPMEKEVTYSVCLEYFKDPVTIECGHNFCRSCLTRFWEESGNKETFCPLCRER
VQQRNLRSNWQLANIIEITKTLPQGPRRAKDTERVCGKHQEPLKLFCKDDETPICCVCDR
SKEHKDHTVIPVEEAAHDYKDLMGNHQDILEREKEKILVYKAEIEKETQDLLKQTEAEME
NIFGEVTEIRQFLEEKEKHLWTQMEELKKQIVRKRDENLAKFDQELSSFKNLIQELKEKC
QQPPAELLQDLKIELQRLWQKPVQVDPVSVECGHNFCRDSAIFFSLRQSYPNMTANVTLD
PVTASPWLFLSKDCKSVRCADKRRNLPDNPERFSDSLCVLGREGFTKGRHFWEVAIEGKE
DWFVGVARKSVRRKGLVYIGPSEGIWAVGKWRG
Download sequence
Identical sequences 28377.ENSACAP00000007136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]