SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000007409 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000007409
Domain Number 1 Region: 194-427
Classification Level Classification E-value
Superfamily PH domain-like 3.32e-86
Family SSRP1-like 0.00000567
Further Details:      
 
Domain Number 2 Region: 536-616
Classification Level Classification E-value
Superfamily HMG-box 1.31e-25
Family HMG-box 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000007409
Sequence length 705
Comment (Anolis carolinensis)
Sequence
MADTLEFNEIYQEVKGSMNDGRLRLNRQGVIFKNSKTGKVDNIQASELAEGIWRRVALGH
GLKLLTKGGHVYKYDGFRETEFDKLADFFKTHFHLELAEKDLCVKGWNWGTVKFGGQLLS
FDIGEQPVFELPLSNVSQCTTGKNEVTLEFHQNDDAEVSLMEVRFYVPPTQEDGVDPVEA
FAQNVLSKADVIQATGDAICIFRELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPYTTVL
RLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKDEDISLTLNMNEDEVEKRFEG
RLTKNMSGSLYEMVSRVMKALVNRKITVPGNFQGHSGAQCITCSYKASSGLLYPLERGFI
YVHKPPVHIRFDEIAFVNFARGTTTTRSFDFEIETKQGTQYTFSSIEREEYGKLFDFVNA
KKLNIKNRGLKEGMKNMPYDEYAGSDEDTHDAYLERMKEEGKIREEHANDSSEDSGEETD
ESFNPVEEEEDVAEEFDSNASASSSSNEGDSDEKKKPAKKAKIVKERKPRKRQSEGKKGK
DPNAPKRPLSAYMLWLNANRDKIRSESPGMSVTDVSKKAGELWKAMSKEKKEEWDRKAED
AKRDYEKAMKEYNEGGKSDSSKKEKPKKKKKPEKPVKGKPEKKAAVSSKSVPSKSPSKQL
GESFKSKEFVSSDESSSGDDKKEDSDEEEIASTPPSSAESASGSD
Download sequence
Identical sequences G1KGS3
XP_003215015.1.98722 28377.ENSACAP00000007409 ENSACAP00000007409 ENSACAP00000007409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]