SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000007468 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000007468
Domain Number 1 Region: 885-1011,1206-1395
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.26e-52
Family p120GAP domain-like 0.032
Further Details:      
 
Domain Number 2 Region: 573-677
Classification Level Classification E-value
Superfamily E set domains 1.09e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.062
Further Details:      
 
Domain Number 3 Region: 486-573
Classification Level Classification E-value
Superfamily E set domains 2.42e-16
Family Other IPT/TIG domains 0.018
Further Details:      
 
Domain Number 4 Region: 389-487
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000215
Family Other IPT/TIG domains 0.0089
Further Details:      
 
Domain Number 5 Region: 44-96
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000824
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 3-47
Classification Level Classification E-value
Superfamily Sema domain 0.000000116
Family Sema domain 0.018
Further Details:      
 
Domain Number 7 Region: 343-375
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000288
Family Plexin repeat 0.0028
Further Details:      
 
Domain Number 8 Region: 692-749
Classification Level Classification E-value
Superfamily E set domains 0.0000598
Family E-set domains of sugar-utilizing enzymes 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000007468
Sequence length 1425
Comment (Anolis carolinensis)
Sequence
ALQYENVVAHEGSSILRDLVLSPDLQYLYAMTEKQVTRVPVESCEQYTTCARCLGSRDPH
CGWCVLHNICSRKDRCERADEPQRFASDLRQCVQLTVQPKNISVTMSEVPLVLQAWNVPD
LSAGVNCSFEDFTESESRIDDGRIYCSSPSAKDVIPITRGQGDKRVVKLYLKSKETGKNF
AAVDFVFYNCSVHQSCLSCVNGSFPCHWCKYRHICTHNAADCSFQEGRVNMSEDCPQILP
STQIYIPVGVVKPITLTAKNLPQPQSGQRNYECIFHIPGSPTRVTALRFNSTSIQCQNTS
YFYEGNDISDLPVNLSVVWNGNFIIDNPQNIQAHLYKCSALRESCGLCLKADPRFECGWC
VSEKRCSLRQHCPASESSWMHASNGNSRCADPKITKLFPETGPRQGGTRLTIIGENLGLK
FEDVRSGVWVGKVICIPIESEYISAEQIVCEIGEASPSKTQDAPVEVCVKDCSPSYKAVA
PKSFTFVTPTFSQVIPARGPLSGGTWISIKGKHLNAGSDIAVTIGGQQCTFSWRNAGEIR
CRTPPGQVPGESPILIHINRAILSSPDVMYYYTEDPTIQKIDPEWSINSGGTLLTVTGTN
LATIKEPRIRAKYGNAEAENNCTVHNDTTMVCYAPSIDNPVRSPPELGDRPDEIGFVMDN
VQALLIINKTNFVYYPDPVFEPLPSGMLELKPSSPLILKGRNLVPPASGNSRLNYTVLIG
DTPCALTVSETQLLCESPNLTGQHKVTVNCVRHSPCNVRVSPVVPGHCPSYTCISVRGPE
QQVFLSSVHLSYGKGSRDAERTLKRLQLQMQLGIRVSLECKEAFAELQTDIHELTNDLDG
AGIPFLDYRTYAMRVLFPGIEDHPVLKEMEVWGIKVQANVEKSLTLFGQLLNKKHFLLTF
IRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLR
RTESVAEKMLTNWFTFLLYKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSED
KLIRQQIDYKMLTLNCVNPENENAPEIPVKVLNCDTITQVKEKLLDAVYKGVPYSQRPKA
GDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQNSAYNIS
NSSTFTKSLSRYESMLRTASSPDSLRSRTPMITPDLESGTKLWHLVKNHDHMDQREGDRG
SKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQI
NDYDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKL
GKDSPSNKLLYAKDIPNYKSWVERYYADIAKMPAISDQDMSAYLAEQSRLHLSQFNSMSA
LHEIYSYITKYKDEILAALEKDEQARRQRLRSKLEQAIDTMALSS
Download sequence
Identical sequences 28377.ENSACAP00000007468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]