SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000011811 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000011811
Domain Number 1 Region: 406-626
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.1e-40
Family DBL homology domain (DH-domain) 0.0014
Further Details:      
 
Domain Number 2 Region: 781-981
Classification Level Classification E-value
Superfamily PH domain-like 2.71e-33
Family Pleckstrin-homology domain (PH domain) 0.00015
Further Details:      
 
Domain Number 3 Region: 612-728
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-22
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000011811
Sequence length 983
Comment (Anolis carolinensis)
Sequence
DRKSIVTRTRSLSGKVPGYVPETVPEETGLDNEPSSITTTENLGPSFCLSEGKPMELSRA
LPAKPRHFVLYPRSYSVEGRDIAVSVYGENDNSIMDYNRINRTDDLSLPCVIASSGSFSQ
RNHLPSSGLSTPSSVVDIPPPFELACITKKPVTKSSPSLLIETESPDKYCKKKKSSFKKF
LTLKFKKKTENKVHVDVHISSSRSSSESSYHGPSRVMELDRRSLSSSPQLISRTGKLKAS
ESPTVLFYKDGKRKGTPKTFSRSVSRVESFEDRSRPPFMPLPLTKPRSISFPNADTSDYE
NIPALNSDYENIQIPPRRPARAGTFTEFFEDPSRALSAANENDGYVDMSSFTAFENNKQQ
PTNQETESAYTEPYKVCPISMIPLEDVTSDEEQKSSGDEDSSQGDPSLIHKVKGQSRAHL
IAQDLLSSEKVYVEMLQLLHRDFHEAVLKVLGNKNDSNHEEAKLKEGLNEIPEIYNLHQE
ILEELEEKVLNWEEHQKVAEVFLSRESRFHHHTAYIMHFDRTLALLDEARLKSSQLDIVI
REFEQFRDGNILNVKHQLLKVVERVFQYHVLLTDYLNNLCPDSAEYEDTQAALLIVTEVA
DQANDSMHQGENLQRLVHIEHSVKGQSNLLQPGRMFLKEGTLMKVSGKNRHPRHLFLMND
VLLYTFPQKDGKYRLKNTLAVSGMRVSRPVTEKAQNVLKIEYAENCLILSASSCSERDEW
YNCISRSIPDDYRAHSAAGFHNNVELRERLGISLGERPPTLVPVSHVMMCMNCGCDFKLT
LRRHHCHACGKIVCRNCSRNKYPLKYLKDRLAKVCDGCYTELKRRGESSPSLHLKQRPMS
MSFPTSSSRLSSGAFSSVFHNIHYTSFKRQKKIPSALLEVAASGEGSSISGYLSRCKRGK
RHWKKLWFVIKGKVLYTYTTNEDKVATESMPLLGFTIAPEKDDRNTDAVFHLYHKQTLFY
SFRAEDNNSAQRWIEAMEEASVL
Download sequence
Identical sequences 28377.ENSACAP00000011811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]