SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000014028 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000014028
Domain Number 1 Region: 220-311
Classification Level Classification E-value
Superfamily Immunoglobulin 2.2e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 1579-1672
Classification Level Classification E-value
Superfamily Immunoglobulin 3.1e-20
Family I set domains 0.0077
Further Details:      
 
Domain Number 3 Region: 2-91
Classification Level Classification E-value
Superfamily Immunoglobulin 2.47e-18
Family I set domains 0.025
Further Details:      
 
Domain Number 4 Region: 102-191
Classification Level Classification E-value
Superfamily Immunoglobulin 9.14e-17
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 854-950
Classification Level Classification E-value
Superfamily Immunoglobulin 9.48e-17
Family I set domains 0.017
Further Details:      
 
Domain Number 6 Region: 784-863
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-16
Family I set domains 0.032
Further Details:      
 
Domain Number 7 Region: 1763-1848
Classification Level Classification E-value
Superfamily Immunoglobulin 4.23e-16
Family I set domains 0.021
Further Details:      
 
Domain Number 8 Region: 299-385
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000347
Family I set domains 0.025
Further Details:      
 
Domain Number 9 Region: 694-772
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000351
Family I set domains 0.029
Further Details:      
 
Domain Number 10 Region: 945-1038
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000368
Family I set domains 0.028
Further Details:      
 
Domain Number 11 Region: 1220-1316
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000469
Family I set domains 0.029
Further Details:      
 
Domain Number 12 Region: 1401-1490
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000557
Family I set domains 0.015
Further Details:      
 
Domain Number 13 Region: 1316-1404
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000972
Family I set domains 0.008
Further Details:      
 
Domain Number 14 Region: 1036-1131
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000254
Family I set domains 0.028
Further Details:      
 
Domain Number 15 Region: 1497-1584
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000111
Family I set domains 0.0054
Further Details:      
 
Domain Number 16 Region: 1127-1213
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000158
Family I set domains 0.018
Further Details:      
 
Domain Number 17 Region: 1678-1770
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000305
Family I set domains 0.01
Further Details:      
 
Domain Number 18 Region: 477-577
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000132
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 19 Region: 402-486
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000196
Family I set domains 0.0065
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000014028
Domain Number - Region: 588-678
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000108
Family I set domains 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000014028
Sequence length 1850
Comment (Anolis carolinensis)
Sequence
FLAYPRTFTVQSGDNAVLKWQVTGEPRPSIVWEKDGSELELSGRIFVMADEDAYSLLVSQ
AAPTDSGRYMCKAKNSVGETYAAVTPKVEAREQQPKVNLDAQPPVFLNRPISAQVARGEN
VTFSCRVSGRLSWEKDGHKLSDIFESSHYKVAAEPDDWHSLHIYNVRLPDAGVYVCRAQN
NFGETMAAAVLLRRRHHTEQNGFSDARQNGEVLPRLPTTKAFTVNEGKHAKFRCYVTGKP
KPEIVWQKDGKALSPGRRHLLYEDREGYFILKVLYCTARDCGLYVCTACNTAGQTLSSVR
LYVKEPRVRFQAPLVDVEVLESQDAILECQVPVATIPTVWYLEDKRLHPSPKYLIEEQGL
LRRLTVRDARADDDGIYLCEMEGKGRSIGELSVQGLIVKRLPRKLDVMEGENAAFYVETR
EPVEVPSWGRNGQELLEAPHTLIRSFGKTHLLVLVHVSRHDAGVITFTAGESQTSAQLRV
KCAKRIPPSAPVAAKMCTSRSNAALLTWCPPSDMHRSPPSSYVIERQALGEADWVSCLTT
DVASMVEVPGDGVPQEGDYCFRVCSANQYGCSEHVEFPGSVHLVPKARVQRGLQDVTVHT
GGDATFSVQLSITISGCWFFNRRKLEKEEEDQQYQITHCGTDHALKISQVQLSANGSEVR
FEANGVKECAVLHVQELPLKVIHSNAKEAQAYEAAERVMLTCELSRPDVPVHWYKDGEAV
EERDGVLLESEGALCRLVITSAQAQDSGEYMCDIGGDSVFFNITVTEPPVTVVKSNAEDA
HAYQVSQHVVLSCELSRPNAPVVRWYKDGEEVEESDGFLLEREGSHCQLTIPSAQIHDTG
EFVCDVGGDSVFFNITVTEPPVQVVSSNTDEPHTYQPLDQVTLTCELSRPNVPVHWYKDG
EEVEEREGLRLESEGCHHRLVIASAQVQDTGEFVCDAGGDSVFFNITVTEPPVKVVLSNA
DEAHAYRVGERVVLSCELSRPDAPVCWYKDGEEAEGREGLLMEREGRHCQLIIPSAQVQD
SGEFLCDAGGDSVFFNISIAEPPVKIVHSNADVAHTYQASDRVVLSCMVSCPKALVRWYK
DGEEVEEGEGLLLESEGPYQRLILPSAQVQDTGEFVCDTGTDSAFFTVSVAEPPVQIVYP
AERSVEKQIWASERLELTCEVSIPDAPVRWFKDGLEVDETDNLLLQVEGAERRLLVLQAG
AEDAGEYICETKDESVSFDVKVSDPPVRIVRRDELQTHYRCLASEDLTLSVMLSCPKGEV
KWYKDGEKLQDTERVRLEQDGTCHTLVILGVKRGDAGEYLCDSGDDNLIFYVTVEVPRLV
EIISELHNLTVLEGDDATFKAVVSPDDVVLQWQLNGQDVVPSERLTITKNGLCHTLTIKQ
CRLSDTGIVTVYAEGLMSSARLSVQEAQVLFVQMLHDLVAEEGQDVRLEVELSLESAEVQ
WMKQGILLQQNSKFSMEAHGPQRALTIYNIELADRGTYRCESLHDRTQARMSVEPRKVMV
KKPLSDVETFEKETVTFELELSHPNVSGIWTRDGIRVKPGSTCRVSATGCTHSLTLLGLT
QDDSGTVAFTADTVRSSARLTVQEPPVTMLRLPQDMGIPETGSATFECELSRPLAEVKWY
KDGEEIQMGPTRRMYSVGRRRLLQLNHCSLEDAGEYTCDAGDCRASAKLRVFERQVQILR
DLEDIRVRENENAVFMCEVSLEEVKGEWFRDGERIKVTSTVKIRQEGARHFLLLCCVHPE
DAGQIRFVAKAATSEARLEVEALPIRIVKPLRDKTVLARHKATLECTVSQSRGRVRWFRG
DTEIFAGPKYEICNLDCYRTLVIHCIEPADEGLYTCDALDDCSTARLLVE
Download sequence
Identical sequences 28377.ENSACAP00000014028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]