SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2850.JGI47011 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2850.JGI47011
Domain Number 1 Region: 546-823
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.26e-72
Family Tandem AAA-ATPase domain 0.0000515
Further Details:      
 
Domain Number 2 Region: 299-544
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.29e-63
Family Tandem AAA-ATPase domain 0.0000271
Further Details:      
 
Domain Number 3 Region: 1063-1181
Classification Level Classification E-value
Superfamily Homeodomain-like 2.01e-26
Family SLIDE domain 0.0019
Further Details:      
 
Domain Number 4 Region: 29-95
Classification Level Classification E-value
Superfamily HMG-box 0.000000000157
Family HMG-box 0.0024
Further Details:      
 
Domain Number 5 Region: 915-1007
Classification Level Classification E-value
Superfamily HAND domain of the nucleosome remodeling ATPase ISWI 0.000000392
Family HAND domain of the nucleosome remodeling ATPase ISWI 0.0042
Further Details:      
 
Domain Number 6 Region: 1314-1390
Classification Level Classification E-value
Superfamily HMG-box 0.0000017
Family HMG-box 0.0054
Further Details:      
 
Weak hits

Sequence:  2850.JGI47011
Domain Number - Region: 1008-1054
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0564
Family Myb/SANT domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI47011
Sequence length 1431
Comment (Phaeodactylum tricornutum)
Sequence
MPKKESRGDWVAVAPQFSGASSAVTTQQEIRKPQSAYQYFQKSVADEIKATFAGRKFDIA
EFGRSVRSRWEALSEDARAPYEQQAREDGFRYAQESHQADVATIERREQLQREHNRLLLD
TDGGDQRVTRKGLAKKERRRLKKKNKKTRPSDGQDFVEDDEDNESNADSWEDELSDSEDE
DNVESKKKAQSVPRVFTEKQREYREQKQQEKAQKEAYIVARQQDLRHEKASQAKKRLDFL
LQQSNIFQHFGLVKEDSARYGTRVTMTTTDAENTQRESASTRHGQDHMDPDVDDAAALEE
ADEHAATYLRTQPSTLAFGKMRPYQLEGLNWMIRLQENGVNGILADEMGLGKTLQSISIL
VYMLEFQNVSGPHLILVPKSTLSNWMNEIARWAPTLKAIRFHGDKVTREEIIRSKLEPAM
RDEDREWNVVVTTYEICNIEKNTLNKFAWSYLIIDEAHRLKNEASAFSKTVRLFETRYRV
LLTGTPLQNSLHELWALLNFLVPDVFESAEQFDEWFNLDIEDNDEKNKLISQLHKILRPF
MLRRLKADVEKSLPPKHETILFTGMSAMQKKLYRDILIRDIDAVQGTSGSRTAILNIVMQ
LRKCAGHPYLFPGTEDRSLPPLGEHLVENCGKMVVLDKLLKRLHERGHRVLLFTQMTRVL
DIMEDYLVMRRFPYCRIDGNTSYEQREEYIDAYNAPNSEKFIFLLSTRAGGLGINLQTAD
VVILYDSDWNPQADLQAQDRAHRIGQKRAVQVFRLVTEHTVEEKIVERAQQKLKLDAMVV
QQGRLKDKDKLSHEELLAAVRFGADKIFKSKDSSITDDDIDLVLDQGKQKTQELNDKLKA
ADKGDLLDFKLDGSSVQTFEGVDYSTSALAQAKSQAEMLGIFDLGKRERKEANYNENSLY
QRQIAALQGVKEIKKKKDIRLPKHLRLPRMEEWQMYDREKLQEIQEEEESAFKALPEELQ
KLATMKRVEQVEEAEIEPEPQLPFELPPLLTEERQAEKERLLAEGFSDWNRFHYQAFWRA
SARHGRRQVEKIALEVGKDDQQVARFLSSFWGEVGKNRIAEHEYERVVKFVERGEKKIGE
IKGLERGTRILVGIFDNPWEELEFTHINCKDKLFTIEEDRHLLCWTRKYGYGHWQAIKNA
VRRNPNFRFDYFLRSLPVELLGKRCEQLMKAAEKEVEQIESHLREALGLPTEAIEGQEPT
PIEIPKFHELQRQMNEARKAKAAIERKQLECKVYQLEEEMRVVQDRLNALNRGVNAAPMV
REVSAQSEKENDTRTVPSSSDSLDQGSSGDKQEDGAVAPDGSFLAFPVYDGSELPDEWKK
PFTHFCIQTRREIKSTLSPSEKKNKKRVNELLKERWIHLSEDNKAIWREWCEWDKKRYAY
HLEIYRARRGESADLEVSNKFEEDGVQSVHVPKKRKSTIGGAIPKKIKKDT
Download sequence
Identical sequences B7G256
XP_002181319.1.39622 jgi|Phatr2|47011|estExt_fgenesh1_pg.C_chr_120077 2850.JGI47011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]