SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 288681.BCZK0466 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  288681.BCZK0466
Domain Number 1 Region: 855-964
Classification Level Classification E-value
Superfamily Collagen-binding domain 3.92e-31
Family Collagen-binding domain 0.0000983
Further Details:      
 
Domain Number 2 Region: 733-850
Classification Level Classification E-value
Superfamily PKD domain 1.31e-18
Family PKD domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 288681.BCZK0466
Sequence length 965
Comment (Bacillus cereus ZK)
Sequence
MNKKSKINKVMLSISTMALSLGALQAPVSAEEKVPYNVLKTKPVGIEKPVDEIGHVSKAE
ETLSFQERLKVGDFSQRPASITNKATVKQVKESYSMADLNKMNNQELVETLGSIKWHQIT
DLFQFNEDAKAFYKDKGKMQVVIDELAHRGSTFTKDDSKGIQTFTEVLRSAFYLAFYNNE
LSELNERSFQDKCLPALKAIAKNPNFKLGTAEQDTVVSAYGKLISNASSDVETVQYASNI
LKQYNDNFTTYVNDRMKGQAIYDIMQGIDYDIQSYLIEARKEANETMWYGKVDGFINEIN
RIALLNEVTQENKWLVNNGIYFASRLGKFHSNPNKGLEVVTQAMHMYPRLSEPYFVAVEQ
ITTNYNGKDYSGNTVDLEKIRKEGKEQYLPKTYTFDDGSIVFKTGDKVSEEKIKRLYWAA
KEVKAQYHRVIGNDKALEPGNADDILTIVIYNSPEEYQLNRQLYGYETNNGGIYIEETGT
FFTYERTPEQSIYSLEELFRHEFTHYLQGRYEVPGLFGRGDMYQNERLTWFQEGNAEFFA
GATRTNNVVPRKSIISGLSSDPASRYTAERTLFAKYGSWDFYNYSFALQSYLYTHQFETF
DKIQDLIRANDVKNYDAYRENLSKDLKLNEEYQEYMQHLIDNQDKYNVPEVADDYLAEHA
PKSLTAVEKEITETLPMKDAKMTKHSSQFFNTFTLEGTYTGSVTKGESEDWNAMSKKVNE
ALEQLAQKEWSGYKTVTAYFVNYRVNSSNQFEYDVVFHGIAKDDEENKAPTVNINGPYNG
LVKEGIQFKSDGSKDEDGKIVSYLWDFGDGSTSAEVNPVHVYESEGSYKVALIVKDDKGK
ESKSEITVTVKGGSLTESEPNNRPEEANRIGLNTTIKGSLIGGDHTDVYTFNVASAKNID
ISVLNEYGIGMTWVLHHESDMQNYAAYGQANGNHIEANFNAKPGKYYLYVYKYDNGDGTY
ELSVK
Download sequence
Identical sequences Q63G89
gi|52144755|ref|YP_082073.1| WP_001036399.1.29451 WP_001036399.1.30336 288681.BCZK0466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]