SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 288681.pE33L466_0145 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  288681.pE33L466_0145
Domain Number 1 Region: 863-959
Classification Level Classification E-value
Superfamily Collagen-binding domain 1.96e-27
Family Collagen-binding domain 0.00025
Further Details:      
 
Domain Number 2 Region: 740-849
Classification Level Classification E-value
Superfamily PKD domain 8.24e-19
Family PKD domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 288681.pE33L466_0145
Sequence length 960
Comment (Bacillus cereus ZK)
Sequence
MNKKSKFTQMMLSISTMALSFGSIQTQVSAEEKAPYNVLQIKPIGTETSKDEIVHATKAD
EILTFEERLKVGDFSQRPTLVMKRDESQLKQSYTLAELNKMPDSELIDTLSKISWNQITD
LFQSTQDTKAFYQNKERMNIIIDELGQRGSAFTKEDSKGIETFVELLRSAFYVGYYNNEL
SYLKERGFHDKCLPALKAIAKNPNFTLGTAEQDRVVAAYGKLISNASSDTETVQYAVNIL
KQYNDNLSTYVSDYTKGQAVYEIVKGIDYDIQSYMQDTNKKPNETMWYGKIDNFINEVSR
IALIRNITTENSWLINNGIYYAGRLGKFHSNPYKGLEVITQAMSLYPRLSGPYFVAVEQI
KTNYGGKDYSGNAVDLQKIREEGKRQYLPKTYTFDDGSIVFKTGDKVTEEKIKRLYWAAK
EVKAQYHRVIGNDKALEPGNADDVLTIVIYNNPDEYQLNRQLYGYETNNGGIYIEEKGTF
FTYERTPKQSIYSLEELFRHEFTHYLQGRYEVPGLFGSGEMYQNERLTWFQEGNAEFFAG
STRTNNVVPRKSMISGLSSDPASRYTAKQTLFSKYGSWDFYKYSFALQSYLYNHQFETFD
KLQDLIRANDVKNYDLYRESLSNNTQLNAEYQTYMQQLIDNQDKYNVPQVTNDYLIQHAP
KPLAEVKNEIVDVANIKDEKITKHESQFFNTFTVEGKYTGGTSKGESEDWKTMSKQVNQA
LEQLSHKGWSGYKTVTAYFVNYRVNAANQFEYDIVFHGVATEEKEKTNTIVNMNGPYSGI
VNEEIQFHSDGTKSENGKVISYLWNFGDGATSTEANPTHVYGEKGTYTVELTVKDSRGKE
SKEQTKVTVKQDPQTGESHEEEKVLLFNTLVKGNLVTPDQTDVYTFDVTDPKEVDISVVN
EQNIGMTWVLYHESDMQNYVACGEDEGDVIKGKFAAKPGKYYLNVYKFDDKNGEYSLLVK
Download sequence
Identical sequences Q4V1V2
288681.pE33L466_0145 gi|67078023|ref|YP_245643.1|NC_007103 gi|67078023|ref|YP_245643.1| WP_001036359.1.29451 WP_001036359.1.30336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]