SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290340.AAur_0689 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290340.AAur_0689
Domain Number 1 Region: 1-210
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.75e-47
Family Thioltransferase 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290340.AAur_0689
Sequence length 232
Comment (Arthrobacter aurescens TC1)
Sequence
MKIEIWSDVACPWCYIGKRRFETALAQFPHRDSVDIEWKSYQLDPSVPEHYDGTELDYLS
NRKGMAPEQVKQMFAHVTETAKGEGLDYHFDKVVVANSFTAHRLIHLAASHGRQDAAKEQ
LLSDHFEHGKDIGNQEYLTELGASLQLPADEVAELFTSDKYTDAVNQDINEARAIGVTGV
PFFVIDRKYGISGAQPADLFSQALNQAWQEANPLIPVGASDAEACGPDGCAV
Download sequence
Identical sequences A1R2N0 J7LQA4
gi|119962002|ref|YP_946492.1| 290340.AAur_0689 gi|403525738|ref|YP_006660625.1| WP_011773440.1.67142 WP_011773440.1.83037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]