SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 293614.A1C_02455 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  293614.A1C_02455
Domain Number 1 Region: 4-195
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.12e-61
Family Glutathione peroxidase-like 0.00000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 293614.A1C_02455
Sequence length 200
Comment (Rickettsia akari Hartford)
Sequence
MSVFVGKTAPDFTAKAIMPNNNIDEKFKLSDYAAGDNIVLFFYPLDFTFVCPSEIIAFHN
KLGEFTERRTKVVAVSVDSHFSHLAWKNTPHNKGGLGQVQFPMVSDIKKDISSKYNVLNE
DCFALRGTFLIDKDFIVRHMLVNDLPIGRDINYTLKVIDALTHHQKHGEVCPAGWHKGEE
AITPSHEGIAHYLSSHAEKL
Download sequence
Identical sequences A8GN15
WP_012149424.1.98304 gi|157825578|ref|YP_001493298.1| 293614.A1C_02455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]