SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.C4M982 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4M982
Domain Number 1 Region: 14-240
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 8.37e-73
Family Inorganic pyrophosphatase 0.00000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 294381.C4M982
Sequence length 244
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MSITSIVPNFGTIRTEPVGTLGKKDYRIYFEQEGKKISPWHKIPAFVSKDVVNMVCEIPR
GTNAKMEISTTNKFNPIKQDLNKDGSLRYMKHGNVLNHYGAVPQTWEDLFERDSIVGIPG
DNDPIDIIDISQKKVARGEIVQIKPICALALLDGGETDWKVIGINVNDPLAQTITSANDI
EKTVDEIREWYRVYKVAEGKKLNKYAYGGKAFNQKSTLDIINETHLQYRKLKTTQKKLSK
LALD
Download sequence
Identical sequences A0A175JXM0 C4M982 M2Q2R6 M3SAR5 M7W242 N9V599
jCVI|EHI_124880 EnhiA.00229.a XP_649445.1.49425 294381.C4M982 gi|56465887|gb|EAL44058.1| gi|67466595|ref|XP_649445.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]