SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 296591.Bpro_5033 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  296591.Bpro_5033
Domain Number 1 Region: 284-444,758-858
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.08e-23
Family ABC transporter ATPase domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 17-158,204-260
Classification Level Classification E-value
Superfamily PHP domain-like 6.08e-20
Family PHP domain 0.011
Further Details:      
 
Weak hits

Sequence:  296591.Bpro_5033
Domain Number - Region: 460-492
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.08
Family HLH, helix-loop-helix DNA-binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 296591.Bpro_5033
Sequence length 894
Comment (Polaromonas JS666)
Sequence
MTGKLQECLTQSDGAHFYRGDLHIHSYRASHDVNDIGMTPQAIVDTVVRENLQIIAVADH
NEIGNVQATVLAGASARILVIPAVELSTPEGHLLCYFETVEALAQFHGRLNLADRGLSNS
RCRNAMYACLDLAKELGGFCVLAHVDGGNGLETNDPGGSPHKTDIICHAALLGIELSSAT
SPVRYAPDDSDQVRAHIGKQRIERLGLGERQYLARILSSDSHTLNALGRNASQDRKLTRY
KMATPSFDGLRHALEEGDSRIRLEDEVPTATPFILGATIGGGFLKGQSIHFSRNLNCIIG
GRGTGKSTTFEAVRCLTGSESGAEVVDSEVWPHQLHLFWQDEAGQQHSLSRAIGESLTNL
DDPLDGPIAFELDCFGQGEAARVREQAKGDPLALMKYLDTFTRVHDAIEDERVARNNLQA
QRLKIVDAEKNVAAIPQTQRSLTVVQQQLQAFEAAKGSDVIKLQRSLAMEKSKKEHLNEQ
LAELKDLVEDATLTETATAVRSLVDSGDIVTGRSEAAEIVLAVDEFSAKVRQAQDAIALA
YAQLQSATTGSIGRWTANERPIRDDIETKRIALEAQGIRLDMSHVAKLTAEEAKQQKSLT
ALKTWEPHLKTLRTQYSAMLSNRWQARRKVASLRQAYAIKASRALAEVLSDLQVKLQYVE
SGFAEEAVVIIATALSWRTVNHPKSRLIVEKLTVPGLLDAIAKSQTAPLTSIRVEEDVQQ
FSLAEAKEILDKLGDPSVRAALEQCHVDDLPRLTVTRRVNDGAGVSYMQRDFSQLSLGQQ
QSVLLALILSSDSKRPLIIDQPEDNLDSEFIFHTFVPVLRRAKERRQVIIVTHNANIAVL
GDAEQLIVFKSNSDHSRIVARGSIDDTAARDAACKILEGAREAFTRRAKIYGIT
Download sequence
Identical sequences Q120Y7
gi|91790852|ref|YP_551803.1|NC_007949 WP_011485888.1.11221 gi|91790852|ref|YP_551803.1| 296591.Bpro_5033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]