SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00003737001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00003737001
Domain Number 1 Region: 166-242
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000012
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 2 Region: 261-293
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000275
Family CCCH zinc finger 0.0017
Further Details:      
 
Domain Number 3 Region: 100-132
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000536
Family CCCH zinc finger 0.0023
Further Details:      
 
Domain Number 4 Region: 37-62
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000072
Family CCCH zinc finger 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00003737001
Sequence length 296
Comment (Vitis vinifera)
Sequence
MEVGGKRRGRPDGAAFGNGGFKKSKQETESFSTGIGSKSKPCTKFFSTSGCPFGEGCHFL
HYVPGGYSAVTQMTNLGGNPAMPPIARNPMAPPTIPDGPPTVKTRICNKFNTPEGCKFGD
KCHFAHGELELGRPIVPTHEDPRAMGPMGGRLAGRLEAPPPGLAAAASFGASATAKISVD
ASLAGAIIGKGGVNSKQICRLTGVKLSIKEHESDPNQRNIELEGTFDQIKQASAMVRELI
FNIGSAAGHAKNPTGSAASANNFKTKMCDNFAKGSCTFGDRCHFAHGANELRKPVA
Download sequence
Identical sequences A5AP98
29760.GSVIVG00003737001 XP_002273052.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]