SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 298653.Franean1_5208 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  298653.Franean1_5208
Domain Number 1 Region: 4-267
Classification Level Classification E-value
Superfamily Cgl1923-like 6.54e-84
Family Cgl1923-like 0.00000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 298653.Franean1_5208
Sequence length 307
Comment (Frankia EAN1pec)
Sequence
MLDPRELYEIRSDLDDLGRPVLIEAMTGVVDAGGAVGLASEHLTTALQHERIVTFDVDQL
MDYRSRRPPMVFYEDHWESYDDPVLAIELLHDEAGTPFLLLCGPEPDLHWKRFTKAVQAV
MAELGVRMSVGLNAIPMAVPHTRPCGVTAHATRKELLVGYEPWVRRLSVPGSAGHLLEYE
IGRSGADAMGFAAHVPHYLAQATYPAATEALLSSVSKSTGLLLPLDGLRSAALEVRGEVD
SQIARGGEAADVVKAIEEQYDAFHRGREGEHLPVVDDSEPLPTGEELGAALERFLAEQSE
PGGPQPT
Download sequence
Identical sequences A8L0N3
298653.Franean1_5208 WP_020462680.1.9268 gi|158316964|ref|YP_001509472.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]