SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 298653.Franean1_6997 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  298653.Franean1_6997
Domain Number - Region: 52-104
Classification Level Classification E-value
Superfamily Cgl1923-like 0.0034
Family Cgl1923-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 298653.Franean1_6997
Sequence length 256
Comment (Frankia EAN1pec)
Sequence
MHEDSSRPLPTGPDPTAGGPVGDDAGAGTRTPPADATSWWNGDPTVPAAPGEDTPPAAAV
LVSVVERLAAIEATLTDFHRRADHREAVIDRLHEERLEQRSGVRRALLDPIVTDLIRLYD
GLSAESERMSGGGDSRTSNLLASFADDVELALERCGFDLVRPRPGDRFQSGAQLAASVVP
TDDPARHNTVAEVTQVGVLERDTGRVRRPARTRVFRSRRPGSEGSDATEASPATAAPPAP
PAPSAPAPPSPAQSGL
Download sequence
Identical sequences A8L3R8
gi|158318726|ref|YP_001511234.1| 298653.Franean1_6997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]