SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI152711 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI152711
Domain Number 1 Region: 157-245
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000152
Family Eukaryotic type KH-domain (KH-domain type I) 0.0034
Further Details:      
 
Domain Number 2 Region: 69-138
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000365
Family Eukaryotic type KH-domain (KH-domain type I) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI152711
Sequence length 346
Comment (Laccaria bicolor)
Sequence
RSKWDQPASVEEGTVAKKTDEGRTASEAAAAAAAIAAKIAAQFANGELSAGGLPRDPHDA
EFTHNIDINDVRNRYLLTRGSTQEQIHDETGASVGTRGVWYPDRSKATEKDPPLYIHISA
STKEILQAAIDKVNELIAIDMGSLVEKGDRQREKRKWPEEKLPVALDSIRNFNVRAKVVG
PSGSFVKYIQSETSTRVQIKGIGSGFIDQETGQEEPVPLYIHITGPEEGQVARAKVLTDD
LLIVVRQEHAKQQQMELHQAQAQYAAYSAMGVSRHGYVPPPPSAPAPPPPPGEGPAPPGG
DAAQYAAGPPAPSDTEAYASYWAAYGYDVNSAEFKEWQASQQQQYA
Download sequence
Identical sequences B0DLK6
29883.JGI152711 jgi|Lacbi1|152711|gww1.27.94.1 XP_001884756.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]