SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI178653 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI178653
Domain Number 1 Region: 3-148
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.43e-35
Family Glutathione peroxidase-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI178653
Sequence length 148
Comment (Laccaria bicolor)
Sequence
ATIDIGDSLPSLTLKNEKGEDVQVENLASEKGVILFLVPKADTPGCTNQACGFRDIYPDF
TSLNYDVYCLSADTPAAQTKWQTKKELPYPLLSDPKRLLISALGAGEGGKTKRSHFIFEQ
GGKLVDKKIPVKPADSPKLALDFIKSLQ
Download sequence
Identical sequences B0D611
29883.JGI178653 XP_001879248.1.58555 jgi|Lacbi1|178653|estExt_Genewise1_worm.C_80203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]