SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI187709 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI187709
Domain Number 1 Region: 54-181,214-300
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.86e-29
Family Glycosyl hydrolases family 16 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI187709
Sequence length 333
Comment (Laccaria bicolor)
Sequence
MLFLSTLFLALLPLGALAGKHQDKSLRSRHANHARTLHVRNNTKTFVLQDMYTGQSFLND
WDFFSDPDPTHGSVNFQTKDQAIAKNLAFVQSDGTTVLAVDDTSALPPNSNRDSIRITSK
KTYNGGLFIADFWAMPHGCSVWPAYWSVGPNWPSAGEIDVLEGVHNQPTNQYTLHTGPGC
TLNSDNNRVSANAISSQCASSGDNNNGCAFIDTDTRSYGKPFNMIGGGVYAHLWNSEGIK
MWHFARGEIPADINAKQPNPASWPTPAAFWSAKSCNMNGFHDHQLVIDTTLCGDFAGATY
ASAGCPGTCGGAVQNPANFRFAKWKINYIATYQ
Download sequence
Identical sequences B0CTZ7
XP_001875146.1.58555 29883.JGI187709 jgi|Lacbi1|187709|estExt_GeneWisePlus_worm.C_20314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]