SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI241727 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI241727
Domain Number 1 Region: 49-184
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.53e-19
Family Glutathione peroxidase-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI241727
Sequence length 184
Comment (Laccaria bicolor)
Sequence
MASAIATIAHAAHNVASSLIADAQIQPGAVIPAQEIKEDAPDKTSALVLTGKNIIIGVPG
AFTTPCNAHIPAYIETYEEFKNKGINEIYVVGVNDVFVTNDFSKIFEDDYLSPFKYVAIH
FIADDKAAFIGSLGLLFDATPLLGGQRSKRFVIVTEGDKVLSVAVEVAPPDVTITAAKAV
LAQL
Download sequence
Identical sequences B0E213
29883.JGI241727 jgi|Lacbi1|241727|e_gwh1.83.13.1 XP_001890224.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]