SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI242154 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI242154
Domain Number 1 Region: 73-202
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.09e-27
Family Glutathione S-transferase (GST), C-terminal domain 0.00086
Further Details:      
 
Domain Number 2 Region: 1-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.18e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI242154
Sequence length 210
Comment (Laccaria bicolor)
Sequence
MVLKLYGFHLSTCTQTVATVLYEKNVPFEFIPVDISKGEQKAPEYLVIQPFGQVPYIDDD
GYIVYESRAIARYIAAKYADQGTPLLPKDPKAYGLSEQAASIEAFNFHPHASKPLPKTYR
GLTSDPAVYEAAISALDKHLDVYDTILAKQKYLAGDEITLADIFHVAYGSYLPAAGSNVI
ESKPNVDRWFKEVSGRASWQVVKDGVKSTA
Download sequence
Identical sequences B0E468
XP_001890985.1.58555 29883.JGI242154 jgi|Lacbi1|242154|e_gwh1.242.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]