SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 300852.TTHA0286 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  300852.TTHA0286
Domain Number 1 Region: 151-432
Classification Level Classification E-value
Superfamily Subtilisin-like 1.13e-63
Family Subtilases 0.0000079
Further Details:      
 
Domain Number 2 Region: 561-669
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000196
Family Collagen-binding domain 0.014
Further Details:      
 
Weak hits

Sequence:  300852.TTHA0286
Domain Number - Region: 482-513
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0179
Family Rhamnogalacturonase B, RhgB, middle domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 300852.TTHA0286
Sequence length 689
Comment (Thermus thermophilus HB8)
Sequence
MKKPLILSALALAALLSACSQAPRPTNASPTPGLVTTSEGVRHYQGQVVVGYEDESGLQE
AIRKLGAKEIARIPELKAALLEVPGDAVKASRTLKGLPGLRYAEPHLAQVTPPKDDPVEL
PRGRESGLIPLGNPSDQILDELPQYALDPRHLAAKAAWDRGFEGEGVVVAIIDDPADVTH
PDLAPNWAGKAYDPVTDTTYTSASGWLNFIQGLNAPADLYHGTYVASTVSAPRDGQGIAG
LAPKTKFLPVAIFQPDYVGDFYVARGIVWAVNNGAQVLNNSWGGLGYGQLVKEAFDYALA
NGVVVVASAGNSYKDEVRTPAGYPGIIASAAADGNRNKTDFSTYGRHISSAAPGLDVLLA
NPTWLGGGYGLISGTSFSGPYTAAAAALVKAACPGATPYQVRRALETTTWEKTFTREKGW
GHLHAGQLAELLSQGCAALPAKGAVVRVKVEYFNERGTFPGLLADVILRGKGLKPGDPTD
PTPVYWARTDQNGEAWFYEIAPGEYDIYVAGADLALTGGPPEERGTFVGTLVATPGSSAF
SPDSKLVRLNASEVNLNPTDPYEPNDTLSQAKPIAYGQTTQLAYIFGQPQDYDYFQFTGS
AGDTIKARVYARSSIGGTLDSYLYLLDENGQVLAENDDIIFGQITDSEIIFTLPQDGTYY
LVVTSYTIANGGSDDSPFNKYRLELQKTN
Download sequence
Identical sequences Q5SLK7
gi|55980255|ref|YP_143552.1| 300852.TTHA0286 YP_143552.1.19876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]