SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3055.JGI182403 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI182403
Domain Number 1 Region: 287-362
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.05e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 2 Region: 198-271
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.74e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 3 Region: 122-190
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0009
Further Details:      
 
Domain Number 4 Region: 479-509
Classification Level Classification E-value
Superfamily WW domain 0.00000000356
Family WW domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI182403
Sequence length 511
Comment (Chlamydomonas reinhardtii)
Sequence
MADHEEPPPGTYDGEERAPDVETGNSHLPPPPELHAAPQEHGADQGAVLDAGRSRAEMLA
AIFAAQAGANVVPSDPTGHKRKLDDDEYHDAPDSKRPASMAFGDGSGALPPPPPLGADAP
VAMETIMCPPDKVGRVIGRAGATIRDLEASTGTRIQVDHKAPGDKPVTISGRADEVERAK
RQVLDLISGHGSDAAPAPGEAQKTLECPQGIVGRVIGRGGETIRTLQQASGAHILVNQDF
PEGAARQITISGSQDAVDRAASMVQELIGGEHANTSQVVQRFGVGSTEVLECPKTMVGRI
IGKGGETIKDLQKRFNASIQIDQSAMPCKVTITGPSHTIASARRAIEDLIRSTGPPPGGM
GMGGGSRPPYGAPYGQQYPGGAGGYGGGYGGYGAPGGYGAPGGYPGYGGYGGYPGGAPYG
GYNAGGYGAPGAQSSDPYGAGSSSYNYGGAGGGSSSAAPGAPGSTPAAPGTNGSGSGGSS
PWQALQDDQGRTYYYNSTTGVSQWERPADMP
Download sequence
Identical sequences A8HYR6
jgi|Chlre4|182403|estExt_fgenesh2_kg.C_30171 XP_001696422.1.80978 3055.JGI182403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]