SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3055.JGI182570 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3055.JGI182570
Domain Number - Region: 6-36,107-151,180-194
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00109
Family Pseudo ankyrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI182570
Sequence length 222
Comment (Chlamydomonas reinhardtii)
Sequence
MPLGLQVMQYASEHGHFDAFTYFLDEAGAHASAIDVAIVRDFAFARGRAYANLQQLLGLL
TERGYTFKVADVKMAASWGWPEQPLLAVIQMVVHGDTEEDTVSHWSEAFVCAAHAGAGIR
VLQALRARGAAVDLAAVAAGGSEEALDWAAAELEAEGQGGSCDGVLLTPLGKADAKIVYK
RGNLAALRWLHRRGLLDGRSVSWLAGRVELARAGEARNSSAL
Download sequence
Identical sequences A8I068
3055.JGI182570 XP_001698532.1.80978 jgi|Chlre4|182570|estExt_fgenesh2_kg.C_40054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]