SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000000777 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000000777
Domain Number 1 Region: 411-585
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-51
Family SPRY domain 0.0000375
Further Details:      
 
Domain Number 2 Region: 8-75
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-18
Family RING finger domain, C3HC4 0.005
Further Details:      
 
Domain Number 3 Region: 152-209
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000962
Family B-box zinc-binding domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000000777
Sequence length 592
Comment (Takifugu rubripes)
Sequence
AAPELFSEQELTCSICLDLFDEPVSTPCGHNFCQVCIGGYWASSAVCTCPLCKHQFDERP
QLSVNKVFALIADKYKEAGYSAAGLPVPAPRTKAAPESVPPMTASAEEVVWCDVCTGVKR
PASSSCLTCTASYCPEHEQPHRTSAFYAKHPLMDPREALKGRTCSLHRRLMEVYCRICQR
CICAICVLEEHRTHKTVSVQTERLVKQKLVARTEQEMVNRIKDKETRVSHLKKKMEAAKN
YADAERAELERLLGEVSRSLDRIQSRVVGDIDSQLDAVMSKGEGLVGRLETELSLLTDRR
ATLEVQAINQDHIGFLQSYEEATAPLEETRQNDEDEEFSLHFQLGEVKLGLSEIRDKMED
IRTGERRSRGSGDLMVAESVLSLRGSSASLRRSQWSLRDMKKSKQVTGHKKARVYMEDVT
LNPVTAYPFLILSDDRKQVKRGEKLQFFRNSQQRFDVWSCVIAKEGFSNGRHYWEVFVGD
SKDWKLGVVTEAAQRKGLFDLTPASGYYAIWWSGSHLRALTTPPLTKVKAPPKLRQVGVF
LDMDEGQVTFYNIKSGSEIYSFTRGREFTDRMFPLFGTGDKDVPLVLMTTQH
Download sequence
Identical sequences H2RKW4
ENSTRUP00000000777 ENSTRUP00000000777 31033.ENSTRUP00000000777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]