SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000001618 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000001618
Domain Number 1 Region: 719-945
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.16e-56
Family DBL homology domain (DH-domain) 0.000000227
Further Details:      
 
Domain Number 2 Region: 320-499
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.83e-45
Family Regulator of G-protein signaling, RGS 0.00000184
Further Details:      
 
Domain Number 3 Region: 945-1075
Classification Level Classification E-value
Superfamily PH domain-like 1.14e-30
Family Pleckstrin-homology domain (PH domain) 0.0000257
Further Details:      
 
Domain Number 4 Region: 38-127
Classification Level Classification E-value
Superfamily PDZ domain-like 1.21e-16
Family PDZ domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000001618
Sequence length 1405
Comment (Takifugu rubripes)
Sequence
MSLRQPTSTLDRLSSLTIGDSERRSSSAQQKDPSADLPAESAGPGLVQRCVVVQKDQLGF
GFTVCGERVKLVQNVRPGGAAVGWGQEGDRIIKVNGSLVSTMSHQEVVKLIKSGPFVALT
LQGPPPSTAALPLEPLPPDPPPNQKPPLSGEAPPSPPPPVSSGLSGTPTQRITGPKPLQD
PEVQKHASEILRKMLEQEEAELQNLLGERLKNPSPSLEERIERAKRRAHQVRVKIQQDLE
GARSELVSSYVIAGRLSVDSSEGDVEACESPHSSSSSFRTPQHRRQNSDAYTSDSGGKAQ
IIGPEEEDEDDYSYAFNDMDGPFQDIELLKSRPAHMTVFMRYIFTQLLDPNPLLFYLSVE
AYLGSSTKEARALAPQICSHFLDPDAPLKIKVREEYLSDIESRLHAQEDIRGPLSELQQQ
VLPDIQDQIQDYRNKQMMGLGSLFGEGDLQLLDGDPVKERQVVDRQVAALWEILSKHEED
RSSPLAWAVVLYLRHSGIKLRDSKVFPGLSTEKEKWLAFLKTKKLSGAKKEKDGEDKKRN
PILKYIGKPRNTSQSTFHVPLSPTEVRSGNVRNIIQQFENHTETGEEGGDAADAQRLSSS
SLGEDSMDSPAVSVRLARSESLKAQGEGRRRGAASGTESVPRSRSDVDMEDCGEEREGPV
LRPLQHSASSSASSSSARLRSLENPTPPYTPRSRRRSVDSPLALLPDSPALEEEVCDSQN
WQDTISPQFLATIGQKEVDRQAVIYAPELFTTEVSHLRTLKVLDQVFFQKMRSVLNSEEL
ACIFPNLPQVYELHGSLCEAMRKRRETLVVQDIGDIMLARFEGQAGEEFQEQASQLCSQH
SQAVELIKNKKRKDPRFAQIIQECEASPHCRRLQLKDLLVSEMHRITKYPLLLDKIIKHT
EAGAPDLPLLQRAQACCRGILQTINEVVRETEHRQRLSQYQRRLDAAPQFKNLDLSTKRM
IHEGPLTWKVSKDKQIEIQALLLSDCLVLLQRGPDDRLMLRYPSRWLGGGGTGGGDSKTS
FSPLVKLDSLLVRSVATDNKALYVISTTERQIYELVAGTSSEKNTWKDLLEKTISAADGS
SPQVNHRSTPTMFSSPSVSPVSVSSHVYAGKKEKYQSDSMETQSTDDVQPPSDVPAEQSG
TNPASVSEAALQDVETLRQLILRDLEEEGWSHDSDDTPTNEAASERSPLSGTVLRIAEEG
EPEEDGRRQDEEPPSFQVVRKAVVAGPSSSSVPDDISDDVTLNSQQSSKARGNTFYIVLP
TEQGESITDDPPTPTASDLQEPLEEVTSQQPDEDTPTGGPGQSEGRVDQVEDLAGLQSTH
QSHVIQNVDEIFHTIEGLMSKLRQLKEIEEAHHNLLKTLSDPPNQESEDGQCLSATVSRT
PSLDRGSINGREASTTEPKIQSTGF
Download sequence
Identical sequences H2RNA5
31033.ENSTRUP00000001618 ENSTRUP00000001618 ENSTRUP00000001618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]