SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000004999 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000004999
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily DEATH domain 3.96e-22
Family Caspase recruitment domain, CARD 0.00031
Further Details:      
 
Domain Number 2 Region: 112-195
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000837
Family DEATH domain, DD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000004999
Sequence length 202
Comment (Takifugu rubripes)
Sequence
MEPEHRALLREHRLQLSAQLLVSDTIIPFLYQENVLTRTQVEEIESLATSRQKTLKLLDI
LPNCGPRAFHAFLQSLEDFRWIRDQLLLDLQERAGQESRVHPLTDSWNFPHSRLQRVPSD
QELSRLASRLGAEWESVLLDLGLSVETLFRCRADHSLSAHGAVLAGLVQWRRCGGKGATF
QRLIQSLKKADVHPSVLGEVLT
Download sequence
Identical sequences H2RXX9
ENSTRUP00000004999 ENSTRUP00000004999 31033.ENSTRUP00000004999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]