SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000007821 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000007821
Domain Number 1 Region: 2614-2796
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.26e-35
Family Laminin G-like module 0.0002
Further Details:      
 
Domain Number 2 Region: 2797-2951
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-34
Family Laminin G-like module 0.0000188
Further Details:      
 
Domain Number 3 Region: 2189-2374
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.38e-32
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 2014-2185
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-27
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 2378-2573
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.19e-21
Family Laminin G-like module 0.021
Further Details:      
 
Domain Number 6 Region: 725-778
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000363
Family Laminin-type module 0.0023
Further Details:      
 
Domain Number 7 Region: 778-824
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family Laminin-type module 0.0076
Further Details:      
 
Domain Number 8 Region: 675-727
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000159
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 9 Region: 618-669
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000243
Family Laminin-type module 0.0058
Further Details:      
 
Domain Number 10 Region: 920-968
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000024
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 11 Region: 1349-1388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 12 Region: 1280-1331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000318
Family Laminin-type module 0.0073
Further Details:      
 
Domain Number 13 Region: 338-375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000474
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 14 Region: 269-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000837
Family Laminin-type module 0.067
Further Details:      
 
Weak hits

Sequence:  31033.ENSTRUP00000007821
Domain Number - Region: 827-876
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000558
Family Laminin-type module 0.014
Further Details:      
 
Domain Number - Region: 1386-1427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000642
Family Laminin-type module 0.02
Further Details:      
 
Domain Number - Region: 871-917
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000809
Family Laminin-type module 0.019
Further Details:      
 
Domain Number - Region: 977-1027
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000963
Family Laminin-type module 0.065
Further Details:      
 
Domain Number - Region: 3-81
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000978
Family APC10-like 0.08
Further Details:      
 
Domain Number - Region: 583-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00179
Family Laminin-type module 0.077
Further Details:      
 
Domain Number - Region: 1236-1261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00419
Family Laminin-type module 0.067
Further Details:      
 
Domain Number - Region: 1894-1993
Classification Level Classification E-value
Superfamily Tropomyosin 0.0445
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000007821
Sequence length 2980
Comment (Takifugu rubripes)
Sequence
SERHPITNAIDGTNRWWQSPSIKNGRQFHWVTITLDLKQIFQVAYVIIKAANSPRPGNWI
LERSLDGVTFDPWQYYAISNSECLSHYNVTPRLGPPTYKRDTEVICTSYYSRLNPLENGE
IHTSLINGRPGADDLTPELLDFTSARYIRLRLQRIRTLNADLMMLSTRDPRDIDPIVTRR
YYYSIKDVSVGGMCICYGHAQNCPLDPVTKVLPHTCDCTSVHLFSCSYSPALDHLLQYSP
AHLCCENCVCFCVSVCRSLRYSDFPCVACNCDLRGSESPVCSRDDKHPGKRSCAPGQCVC
KEGFAGERCDTCAFGYRDFPQCVRCECDAAGSTNADPCRPCTCKVNVMGAHCDLCKPGFY
NLQEKNPLGCTDCFCFGVSDVCESSAWSTTQVLHRDAWLLPRPAPQNITVLQDNDLPSPG
NTSSGHSHQDVLLWDAPDGFLGNKLGSYGGFLNYSLLYDIPSDNEDRSIPAHSDVMIKGN
GRALHSIPHFLFVSPLAESAVAIVMVDGQFRDVQSGDPVSRDELLSALADVTTLTVRVGL
NATADGPIRLSWISLDAADPGPGSALDAADPGPGSAQQAVAVEKCECPWGYTGTSCETCL
PGFYRVGGVLFGGNCMQCECNDHASECDISGDCWGCTHNTSGPRCEQCLPGFYGNATEGT
ADDCQLCPCPLTNPSNSFSPTCVLEGSGKVVCDQCQEGHTGSNCERCASGFYGNPRAANG
TCVRCDCHGNVNASEAGHCDVITGECLRCLFNTGGRHCEVCQPGYYGDAVLAKNCQECGC
DVNGAPSSVCDVTTGQCLCKENVTGRTCDQCQSGFFGLHSEMGCQLCGCNQSGSLSESCD
EQGRCPCVKGVGGDKCDRCGHGYYGVDVSSCRACNCVDTGGNCDPQSGECMCPAFTEGPN
CNRCEAGYWGHDPTTGCTPCSCSKDGSSAPDCDATSGQCWCRKGFGGRSCDHCAAGHHGY
PSCLPCGCDLAGTDEKFCNTTLNTCDCLDTGVCVCKVGVSGRRCEECVAGRFALSVDNPD
GCSPCFCSGVSGDCEEQGGLIRLPVTLDQSPGLLSVVSQLNLQGVVSGVYQQGGDMLLDT
RHLNTSGLAGPLYWRLPPQFEGQQLLSYGGSLSYIITFYAEDGAGLSNQEPQIMIKGGTL
KKMVIYMDVVAPSNGIRTNHEIRMTEHKWKYFNSVLETSVGRSDFMSVLGNIEYVLIKAS
YGSRLQQSRISNITMETALENEDGSEVGGDMARSIESCICPTGYTGLSCQDCAAGFFRQP
LSELSPQSQRLMSVRPCVPCRCNNHSESCDAASGECQQCQHHTSGWSCQQCSQGYHGNVS
GSISDCSLCACPLKDNSFSLTCVSEGVLGDFRCTACVPGYEGRYCEKCSVGYYGNPTLPG
GVCSRCNCSGWGSLQPLCDQLNGKCDCKAGVKGQSCDQCEDRHILQEGECVSCEDNCTGV
MLNDLEDLDDHLAAVNISSFVVASYLRLAALENQTRGVQLSGLEEQLGLMSLDLGVLLQL
VKQRLENTTLVLKPDAEPSLCVFPKLGGDLQRLDTSAQDTIHQGSQQIQNINILQDKEAE
RLNATAEEELTTANRTHLLQELELMLRSMRVTNLTAASSLANQELLRATSVLSLQSDLLS
RRAAVDDGLRHLSTSLSSNSGTLRHLQAQLSGATQQNMQTHVLLEVLHNLTQQHQSVQQD
ISQERLLVAGLMQDTQLVLGDSLSIMEDLTNTTSQVEVFGSYLDQWSPLLRKRVDGLVGG
LKMTDSLEKVYLSEKHAQQLENDAHSLHSSLLSVYNASQNGSQLLQGGNSGVPEQVEALR
QEALMADRSARLLFNATVQSEPPLPEESRTRLNISAAVLETCRQIGASSADLQMNVSMVT
SRLGLFKESFQKFGLLFHHSVTELQSLSNGSLTELQQVQLQAAEADSRLQGALLRLQKLR
QQLQDSSSAVENTSNTVTETQQLTALTHSTVDQARQKLGEVERRTERLIDQIKPLSMLGE
TINRNLSDIRELINQARRQAASIKVAVQADRSCVRSYRPQSESRNFNTLSLVLRTSSPNN
LLFFQGSNTTVDFLALEMYRGKVSLLWDLGSGSTRLEFPGLDITNNRWTRINATRFGAHA
SLWVHQLESDSEPLPAVTATSPGPARILDTDRNSWLYIGGLGAHGQRPAALRSTTFQGCL
GEAALNERNIGLWNYHRREGECGGCFSSPQTEETSFHFDGSGFSLVQKPLRATSTSIVLL
FKTLSPGGLLLYLASNNTRDFLSIELVEGQVRLTFDLGSGALVLTSSRKYNTGVWYKITL
QRNKRKGYLSIMAADQPSEKEVLEAESPGLASDLNRSDFDPIYIGGLPASRPISLLVRRQ
VVSRAYVGCIKNVEIARSNFDLLRDAFGVRKGCVLEALRSVSLLTGGFVQMAPRALGPEV
ELLFSFSTNNRSGILLAAVTDDHVQRRVGRKVDVQRFLSIHLASGAVEADIGEVGGATQT
VTVVKPKGGFFSDGLKHSVIVTVNKKTLSIQVDETHLKSIPLLPGRFSNLSPASFFIGGV
PVGAGLQLPSRLRQISLSFRGCIQHLVLGGGALVDLSGALRYEGVTLDSCLLEEAARGAV
LPDDPDTEPTMDPVRLPVVPPTPLGVLPPGALTCAAQVDSSFLPSAAQFGLSKHSHMTFL
INPGALRKSVSLKISARTRSPDGLLLLLSDAKQMDFAVVKLAGGKVTLSADLGKGPTSVT
SPVSITDGLWHTVSAEVSRRSLVLAVDGSKPGSASIRGNQLDVDRRLYLGGLPHAHATRR
INVSSSFQGCVRSVHLNGAVLDLTKPASRHNVTSCFTDDQAGSYFDGSGHALFMRDGYKV
GSDVSVSLEFRTSQSEGVFLGISSAKIDAIGLEMIKGQVVFNVNNGAGRVTVRSVGPMLC
DGRWHRVLARKTKHSLNLQVDGRSYITPNPYPQSTSAETKNPVYLGGYPVGVKQNCLSIT
TRFRGCLKKIQLIKPHLSDMLDLSSAHVLSGVTPDSCPVG
Download sequence
Identical sequences H2S5Z9
ENSTRUP00000007821 ENSTRUP00000007821 31033.ENSTRUP00000007821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]