SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000008614 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000008614
Domain Number 1 Region: 339-531
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.62e-33
Family Pentraxin (pentaxin) 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000008614
Sequence length 547
Comment (Takifugu rubripes)
Sequence
IMKFMVVLVGAGALAFLGAVICIIASVYPRKRAAPLSDNGTLTSETLLQPLEPGSVAHAG
PLGALHGAESYGGGNGLGGIGLEVPTLNELNLGEDIGGGSAKQFSFSRLICTPVPAGDCN
TKDMRQRREQQQQQQADDPLFGAVEEDWTYLRTTAEELRQMVLQQNDQILMDHRTIRELT
GKLSECESGLEDERNVPERSVNVWNGNRRVMAGDDVSSSAAAQLQTARAVEELARAIMDL
QDRIEKLEAEIGPAALNLTDSSLGSNSGGATPGRAKSTWRVEDLEGELERKIKMLEKERQ
SMRKETQGQHEKINHGLDTVNQRISELEHTLVEPSFPEGFVLSFPMRTNYMYGLVRKEIT
EMYAFTACLWLKAKEGGIGTPFSYSVPGQTNELVLLQGVRSPVELLINDKVAQLPLSLPQ
DQWQHICVSWTLRDGVWKAYQGGLKGRGEGLAAWHPIKPGGVLILGQEQDTLGGQFDASQ
ALVGELSQFNLWDRLLKPAEVAALADCSSFALGNIAPWTDHDVDVYGGATKESLDPCHAA
QRSNPSS
Download sequence
Identical sequences H2S889
ENSTRUP00000008614 31033.ENSTRUP00000008614 ENSTRUP00000008614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]