SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000013241 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000013241
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.28e-47
Family Calponin-homology domain, CH-domain 0.000000621
Further Details:      
 
Domain Number 2 Region: 185-244
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 5.62e-19
Family EB1 dimerisation domain-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000013241
Sequence length 260
Comment (Takifugu rubripes)
Sequence
MALNVFSTSMTTENLSRHDMLAWVNDTLQLTYTKIEQMCSGTAYCQFMDMLFPGCIMMKK
VKFNAKLEHEYIYNFKILQLSFKKMDVDKIVPVERLVKGKFQDNFEFLQWFKKFFDANWD
GKDYDPVLTRQGPETTLPPSHPGSLRSSPSPTAVKPVPTPPRQNSAAAPRRTTSVTRNGV
DAEVLVLSQQLSELKLGVEGLEKERDFYFRKLRDIEVICQEHENDHPGISRIIEVLYATE
DGFAPPEDSEDEEQGDHWES
Download sequence
Identical sequences H2SLF5
XP_011610602.1.43653 ENSTRUP00000013241 ENSTRUP00000013241 31033.ENSTRUP00000013241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]