SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000014067 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000014067
Domain Number 1 Region: 413-627
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-38
Family DBL homology domain (DH-domain) 0.00065
Further Details:      
 
Domain Number 2 Region: 784-978
Classification Level Classification E-value
Superfamily PH domain-like 5.9e-29
Family Pleckstrin-homology domain (PH domain) 0.00012
Further Details:      
 
Domain Number 3 Region: 615-731
Classification Level Classification E-value
Superfamily PH domain-like 1.86e-20
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000014067
Sequence length 980
Comment (Takifugu rubripes)
Sequence
DSEGENFLALDRKTVVTRSRSYSGKFSGYVPETVPEETGTEYQTHDYCSTALNSTNDASD
LSRQPGVNSSILPMKSRRFLLYSRSAEGPELSLTSPSEVGPSLKDELRMKRKDDNLSLPC
VMSSSGSFSQRSHQSSSGVSTPTSLVDIPPPFELAYIIKRPVTKSSPSLFIHHEPSDINK
KKKSSFKRFLALKFKKKSDSKSFSDGSVRSSRSSSESSHHGPGRVIELDRRSASSSPRLQ
SNVINPQQRAPDMPSAFVQHHRRKSYGRGVSRVESFEERSRRSPMPLPLTKPRSISFPSA
DTSDYENIPAMSSDYENIQIPGRPARSHTVTEFFEDTSRTAVPCNENDGYVDMNSFPGID
TKPQMSKADAESAYTEPFPMNSISALLSADEAHGRTSEEEEGAGEPSCDRQIDGRSRAFY
IAKELADSERLHVSVLKHLQEDFRSAVTEAEGEEGGPVLEEQRLGEILGVLPQVYALHSS
ILTELEEHISQWDDNQSIVNVLLSRREDFRVFDTYISEYDRSMSLLEESCRDNLAFASIV
KKFEKRSPEEAEVPLKHQLLQVIVRVLQYRMLLTDYLNNLSPDSKEYEDTQAALVIVSEV
SDEANDNLKQGENLLRLVHIEYSLKGKRDLLKAGRMFVKEGTLMKVLKKSRLPRHLFLMN
DIMLYTYPQQDGKYLLKNTLSLSGMKVSKPVIDDVLNCLRIEVSDITITLSASSVGERED
WFHTLSRAIADHYLQAVLNAVLSHMHPQAREKLWMALGEAAPVLVPVSHVMMCMNCTTDF
SLTLRRHHCNACGKVVCRACSRNRYPLKYLKDRVAKVCDHCYAELRKKGGSVSVVCSNSS
PRTHRASRPLSAVFQSLQPPSLWKNKKCSSSLNQVSLALEGSTMSGSLQRRKKSKRKWKR
LWFLLKDKVLYTFTACEDKVASESLPLQGFTVKLTEKSEGEESSSMFQLYHKKTLYYTFR
ADDHHTARRWVNAMEEATVL
Download sequence
Identical sequences H2SNT0
ENSTRUP00000014067 31033.ENSTRUP00000014067 ENSTRUP00000014067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]