SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000014893 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000014893
Domain Number 1 Region: 763-1078
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.83e-50
Family Ankyrin repeat 0.0000436
Further Details:      
 
Domain Number 2 Region: 451-712
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.06e-44
Family Ankyrin repeat 0.00032
Further Details:      
 
Domain Number 3 Region: 226-416,448-529
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.86e-41
Family Ankyrin repeat 0.00036
Further Details:      
 
Domain Number 4 Region: 50-163
Classification Level Classification E-value
Superfamily POZ domain 3.3e-20
Family BTB/POZ domain 0.0062
Further Details:      
 
Domain Number 5 Region: 1103-1162
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.11e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000014893
Sequence length 1168
Comment (Takifugu rubripes)
Sequence
CGTEEVAKLQKHLALLRQEYVKMQQKLADTERRCAMLAAQNPGQTSPTSVAASTFISRLL
DIVADLYLQEQYSDLAVKVAGKTLGAHKFVLAARSDVWSLANLASTTELDLSDCKPEVAM
AMLRWVYTDELELTEDDAFLIDLMKLANRFHLQVLRERCEKGVMSSVNVRNCIRFYQTAE
ELNAGTLMNYCGEIIASHWDDLRKEDFSSMSAQLLYKMIKSKTEYPLHKAIKVEREDVVF
LYLIEMDSQLPAKLNELDNNGDLALDLALSRKLESIATTLVNNKADVDMVDQSGWSLLHK
AIQRGDEFASVFLIGHSAQVNAATVGAVETPLHLVCSFSPKKHSAEVMGGMARIAEALLK
TGANANMQNSKGRYRTPLHEAVASGNEPVFNQLLQCKQLDLELKDHEGSTALWLALQYIT
LASDASVNPFEDDAPVVNGTSFKENSFAAQLIQRGSNADAPDSATGYCLMQRAALAGSEA
AALFLATHGAKVNHVNKWGESPLHTACRCGLAGLTAELLQQGANPNLQTQKPLPEDASGV
AMQSPLHMAIAHNHPDVVSVILEQKANALHATNNFQIIPDFSLKDSLDQTVLGLALWTGM
HTIAAQLLGSGASINDTMSSGQTLLHMAIQRQDSKSALFLLEHQADINISTQEGETALQL
AISHQLPLVVDAICTRGADMSVVNDSGDPPLWLALASNLEDIASTLVRHGCDVTCWSTGP
SGCQQTLLHRAIDENNEVSACFLIRSGCDLNSCRRPGPNGEGDEEARDGQTPLHLASSWG
LEEVVQCLLEFAANVNAQDAEGRAPIHVAISNQHSVIIQLLISHPDIRLNVRDRQGMTPF
ACAMTHKNNKAAEAIIKREPGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVQANVNSRV
QDAAKLSPLHLAVQAGSEIIVRNLLLAGARINELTKHRQTALHLAAQQDLATICSVLLEN
GVDFAAEDENGNNALHLAVMQGRLNNVRALLTESNIDAEAFNLRGHSPMHVLGHYGKENA
AAIFELFLECMPEYPLDKPDNEGNTVLLLAYMKGNANLCRAIVRAGARLGVTNNQGINIF
NYQVATKQLLFRLLDMLSKEPPWCDGSNCYECTAKFGVTTRKHHCRHCGRLLCHKCSIKE
IPIIKFDLNKPVRVCDICFDVLTLGGVS
Download sequence
Identical sequences H2SR56
31033.ENSTRUP00000014893 ENSTRUP00000014893 ENSTRUP00000014893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]