SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000018286 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000018286
Domain Number 1 Region: 12-272
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-71
Family Nuclear receptor ligand-binding domain 0.00000000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000018286
Sequence length 316
Comment (Takifugu rubripes)
Sequence
IRKLIPILCSPSAVRNDRNKKKKESPKPELAESYELTAELETIIEKIRKAHQETFPSLCQ
LGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRVPGFTALTIADQITLLKAA
CLDILILRICTRYTPDQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPIEMDDT
ETGLLSAICLISGDRQDLEEPSKVDQLQEPLLEALKIYVRKRRPSKPHMFPKTLMKITDL
RSISAKGAERVISLKMEIPGSMPPLIQEMLENSEGQDGQSSSSSSSSSASADGGASPSSK
SSPDEEDATVATPESP
Download sequence
Identical sequences H2T0U8
ENSTRUP00000018286 31033.ENSTRUP00000018286 ENSTRUP00000018286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]