SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000018412 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000018412
Domain Number 1 Region: 662-908
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.19e-61
Family Nuclear receptor ligand-binding domain 0.000000004
Further Details:      
 
Domain Number 2 Region: 558-604
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000285
Family Nuclear receptor 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000018412
Sequence length 909
Comment (Takifugu rubripes)
Sequence
MDKDGVKKVTYRRDDPLRKLVYTESPEEGGLLKVAPHGAMSITSATPSQLLQPGQVSNGL
GNSSFPEELAPGTANVSHLSENPEIKGPTKDQKLQEQQLCFLHTSTSLGGQILRESLPQL
EANTIDGTQSSMDSLIGGSDPNFFPMKTDDFSMDNGDQDPIEIDPSFEPIRKDGDVHQKL
FSDNTLDLLQDFELIGSPSDFYVGDDALLYSLAEDSLLGDASSEKDLKSVVVEGVAGSGA
LSALNGSNILSPDQSSISTTASLMPSPALSVVVKKEKDADFIQLHTPGVIKEEKTSPGQN
YCQMSSASSPEMLSSIISVCGVSTSGGQSYHFGVSPSSGEAQQQRNQNQKPVSNQYLPVT
TLSGAWSREGESAAVHKVAEAFSRSPSYPVCFTSGHVSFNNRKRPLFQTLGPELVLCSPL
FNRAYLPNGHSASLLLFVAATISQTCTGCHWEGFYDAVPPTDRKVSLRRQLCRERVGVKS
AWFALMRRQVVTTEFSPAGAARSSSKEQSKVPRSHSQPLKPFVVVGLSHNHFKVKDDVTV
NEIDEGKHINLTPLCTSGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLMAGMNLEVYLH
PHLSLCFTKTLFSMFFSCAARKTKKLNRLKGVQQSNPPKPTTPCLPVEPCSLVPKCMPQL
VPTMLSLLKAIEPETIYAGYDSTVPDTSTRLMTTLNRLGGQQVISAVKWAKALPGFRNLH
LDDQMTLLQYSWLFLMSFSLGWRSYQQCNGNMLCFAPDLVINEERMKLPYMADQCEQMLK
ISSEFVRLQVSHDEYLCMKVLLLLSTVPKDGLKSQAVFDDIRMSYIKELGKAIVKREQNS
SQNWQRFYQLTKLLDSMHEMVGGLLRFCFYTFVNKSLSVEFPEMLAEIISNQLPKFKAGS
IKPLLFHQR
Download sequence
Identical sequences H2T174
ENSTRUP00000018412 ENSTRUP00000018412 31033.ENSTRUP00000018412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]