SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000025466 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000025466
Domain Number 1 Region: 151-250
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.69e-31
Family Ras-binding domain, RBD 0.0031
Further Details:      
 
Domain Number 2 Region: 291-399
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000011
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000025466
Sequence length 659
Comment (Takifugu rubripes)
Sequence
MDDIDAMFSEMLGEMDLLTKSLDQEMAPPDAPPSTSEEVSFSIGFPDLNESLQELEDSDL
DALMADLVADLNATEQKLAAEIEDLKVPPPPQPHLPPKSRGAVSTSSSCSPSPASSATSP
LPVPPPQSVKPSMEEIEAQMKADKIKLALEKLKEAKVKKLVVKVLLNDGSSKTLMVDERQ
SVRDVLDNLFEKTHCDCNVDWSLCETNAELQLERTFEDHENLVEPLLAWTRDSQNKVFFQ
ERPEKNEVFKNPQNFYLWKKDKKTLQAIKDKDKEILIKENFCGTSIIVPDLEAVLHLRED
GKKSWKQRLFQLRASGLYYVPKGKTKSSRDLICFVQFDNLNVYYGKDFRSKYKAPTEFCF
VLKHPQIQKESQYIKYLCCDDAWTMNLWVAGIRIAKYGTALHQNYQTALRKAAVTSAWTN
CSKPSSDGPPTPPTTIKASPANGHVPKPPPGAAPQDVFPPPPPPMDVLPPPPPDPAFPPP
PPPLMAKRSPKPSAGHRQAPGDHLPPPPLAPPHDDASEDPPDFLPPPPPSFDSLPPPPPG
MSAFPPPPPLLGFSETSQPLPPPPPDPELLLPPPPASMISTGAGAPPPPPPPPPPPAAAA
ASPRPAPTASGSVRKRPPAPPKRTTPALHGSGGGAGEGAGGGDFMSELMKAMNKKRADH
Download sequence
Identical sequences H2TLB1
ENSTRUP00000025466 31033.ENSTRUP00000025466 ENSTRUP00000025466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]