SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000025911 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000025911
Domain Number 1 Region: 336-427
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 9.81e-36
Family Small-conductance potassium channel 0.00000649
Further Details:      
 
Domain Number 2 Region: 205-376
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.23e-25
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000025911
Sequence length 477
Comment (Takifugu rubripes)
Sequence
SRSTLSDVGSGQHPLRLLHSAILEDAFSKVIREDSNKANSENATGEEGSAKQKKTKDIGY
RLGQRKALFGKRKLLSDYALVCGMFGILVMVIETELSRVFYSKESIYSHVLKGMISTSTA
VLLVLIVMYHAREIQLFMVDNGADDWRIAMTFERILFVLLELLVCAIHPVPGQSVFSWTT
RLARSYTAAAADADVDVLLSVPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKISFDTR
FVMKTLMTICPGTVLLVFSVSCWIIAAWTVRVCERYHNAHEVTSTFLGAMWLISITFLSI
GYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKSELTRAEKHVHNFMMDTQLYKKI
KNTAANVLRETWLIYKNTKLVKKVDRAKIRHHQRKFLQSIHQLRALKMEQRKLTDQANTV
ADLAKTQNMMYDLLTELQHRREDLDRRIVALEEKLDSVLLCVQSLPVVLSQAITKLQ
Download sequence
Identical sequences H2TMK5
31033.ENSTRUP00000025911 ENSTRUP00000025911 ENSTRUP00000025911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]