SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000026513 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000026513
Domain Number 1 Region: 476-649
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-49
Family SPRY domain 0.00052
Further Details:      
 
Domain Number 2 Region: 11-82
Classification Level Classification E-value
Superfamily RING/U-box 3.09e-18
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 152-217
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000336
Family B-box zinc-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000026513
Sequence length 662
Comment (Takifugu rubripes)
Sequence
TIRMTSKLWTNEQFNCPVCLDLPNDPVTIPCGHSYCMACIKDFWSNDEPKGIYSCPQCRQ
VFCPMPPLSKNTMLADAVEQLRKGALKADVRDSIRSARGGTTSSSRPKAVACDMCKGEQR
EAVKSCLVCMSSYCEAHLKPHQTKKALKQHELVAPTSNLAEKICTQHKYLQEFFCRQCKT
FICWLCTSNQHKGHESVSTKVERLEKQKVLSDLQAETQQRLKEREQELKNLKKVMEVTKK
SQILTNPRTIIVSFPAQRSAIKVHSDTEQTLKELQRSVERLQELMEEVLDQANLEKMSQA
QEVADSLEAEIKVLKKRDSDMKDLAQSLFKPVTVTSEFFLSLSASRNAQKGGIFKHVKSS
GRIFIQLLVPFLVFSGLASRNTNTRSPGLRNQDVRSRDTPRVYQFTGPPSVSETTSIRNP
SPTPSRRETQSLWSRSINPSLFLDSPTPASMNHTPAFPALREINIDSLQAPEPRSREEFL
QYSVTLTLDPNTAHRRLGISEGNTKATLQGAAQPYPDTPERFDGWTQVMCQGPMYAQRCY
WEVEWRGRGSSIGVAYGAMSRKGSDAMSGLGYNARSWTLELSDTCCAALHDNQKRDIPVT
YSPRLGIYLDLSSGMLAFYSVADTMTHLHTFHANFTQPLYAVFGVGSGVGVGLDFALGKF
NS
Download sequence
Identical sequences H2TPA7
31033.ENSTRUP00000026513 ENSTRUP00000026513 ENSTRUP00000026513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]