SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000027304 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000027304
Domain Number 1 Region: 366-484
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.37e-33
Family Calponin-homology domain, CH-domain 0.0000948
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000027304
Sequence length 486
Comment (Takifugu rubripes)
Sequence
ADMGDLCHPRSSSPEGETVCAALARYESTLRDAIREIHVDVSAFKLGMERRLEETANLSG
PLGRAVLHLQQENRQLRVQLEALARQVELLGGMSCERNTVLNNSHYHSSSRGSSSPPVGS
KATAVTSGPVSGSSPSPARFSSRATFAVCSKNNSIEKEEPIEVDHAPTHAGLENGHSTEQ
SVLVHGKISPPSDRRHGHAAPVATPHLPITATTKVAEIKRPGSPGSPAGSPPSPASEESP
LSQSAAGAKQSPPPTGEPAPAVFLSVPSSWTSTPARSLGSPRLQERASSAKSVTYSGLLH
DRDGPSSCDRSFGPVGDRRRELVRSQTLPRNIGAQARRSIFQRLEADAGNSNSRPLAVDS
KPKLKRSQSFGVSSASSIKQILLEWCRSKTVGYQNIDIQNFSSSWSDGMAFCALVHSFFP
TEFDYDSLSPANRKHNFELAFGTAEAKAGCDRLIEVDDMMIMGRKPDPMCVFTYVQSLYN
HLRKFE
Download sequence
Identical sequences H2TRJ7
ENSTRUP00000027304 31033.ENSTRUP00000027304 ENSTRUP00000027304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]