SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000028082 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000028082
Domain Number 1 Region: 343-552
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-45
Family DBL homology domain (DH-domain) 0.00054
Further Details:      
 
Domain Number 2 Region: 707-909
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-28
Family Pleckstrin-homology domain (PH domain) 0.00013
Further Details:      
 
Domain Number 3 Region: 542-657
Classification Level Classification E-value
Superfamily PH domain-like 8.73e-19
Family Pleckstrin-homology domain (PH domain) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000028082
Sequence length 911
Comment (Takifugu rubripes)
Sequence
AKPLYLSRYPRSISMEGQEASVYSYMEGSPKHRGAACLSGGFPRFSPSSSVLSTPTSAVD
IPPPFELAYITKRPITKSSPSLFVEDDASEKNRKKKSSIKHFLMLKFRRKTDSKSAVDVS
ASSFKSSSESVQHTSSRLLDPDRQALSSSPQPTSHYARPRLSHAPPSTFYNKGNGSAVAF
LNRSIVRVESFEDRSRAPFIPLPLTKPRSISFPNTDTSDYENVPPISSDYENVQVPQRRP
VRQVPFPEFFGRPARGLSSANETDGYVDMSSLPGFKGKTQQPVEETESAYTEAYKVCLLA
AAPQAAPAGDVRGETTGEEDAGCTSDEEEGGSGSTYERQAGRSRAFYIAKELVDTERAHV
NTLKLLQEDFREAVGAAVGEEGEPLLNEDRLREILNELPDIYTLHRRILNELENRIRHWD
EQQRIADVFLSRTAEFLVFTTYIGHYDRSVSLLEDSCRASPALSAIVHQFEQSPAAQTVS
LKHQLLQVIVRVAQYRLILTDYLNNLSPDSKEYEDTQAAVAAVSEIADQANDSLKDGENL
LRLVNIEYSVRGQRELLQPGRVFVKEGTLMNVSRRSQQPRHLFLMNDVLLYTYPQQDGKY
RLKNRLSLTGLKVSKPIIENVQNALRIEGTDISITLSASSFIEREDWFYTISRTVSEHAQ
SSAAFSSCPREARDPLRLCLGEKAPTLVPVSQVMMCMNCTSDFSLTLRRHHCHSCGRIVC
RSCSRNRYPLKYMKDRMAKVCDHCYNELRKRACPQPLCVVHHRVSAHIQSSPRPHRSSRP
LSAVFQNIHPPNIWRHRKGIVTFTQVTVSEEGSISGSLQRSKKSKRSWKRLWFLLKDKVL
YTYRAQEEKVASETLPLLGFTVKPPDRQLSEEEEASIFRLYHKSTLYYTFKAADIHTAQR
WVNAMEEATVL
Download sequence
Identical sequences H2TTS4
31033.ENSTRUP00000028082 ENSTRUP00000028082 ENSTRUP00000028082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]