SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000032657 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000032657
Domain Number 1 Region: 587-687
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.39e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 2 Region: 1046-1121
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.48e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000516
Further Details:      
 
Domain Number 3 Region: 729-802
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.07e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 4 Region: 134-220
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.57e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000307
Further Details:      
 
Domain Number 5 Region: 441-510
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.01e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.000076
Further Details:      
 
Domain Number 6 Region: 969-1045
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.08e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000333
Further Details:      
 
Domain Number 7 Region: 348-434
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.45e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000218
Further Details:      
 
Domain Number 8 Region: 503-580
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.06e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 9 Region: 1119-1200
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000219
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000438
Further Details:      
 
Domain Number 10 Region: 293-368
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000057
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 11 Region: 869-968
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000891
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 12 Region: 797-878
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000336
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 13 Region: 221-295
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000482
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000032657
Sequence length 1276
Comment (Takifugu rubripes)
Sequence
MSSVAVLTPESFAEHRSGLKDQEIPASVVLGCVPEDEAYIPTYLEAFPPLPEKGAPGEKA
GEPAPAWGSKIRPIKASVITQVFHVPLEERRYKDNSQFGEGEEAKVCLDIMQRTGAHIEL
SLAKDQGLSIMVTGKLDNVMKARKEIVARLQTQASATVAIPKEHHRFVIGKNGEKLQELE
LKTATKIAIPRPDDPSANIRITGTKEGIEKARHEILLISAEQDKRAVERLSLEKVFHPFI
AGAHNRLVQELGQETGARISVPPPSLPKDEIVITGEKEAVALALNRIRAIYEDKKRKTTT
ISVEVKKSQHKYIIGPKGNTLQEILEATGVSVEMPPLDSSSETIILRGEPDKLGPALTQV
YAKAKSVMVVEVTAPAWLHRFIIGKKGQNIGRITQQLPRVHIEFTDGEERICLEGPTEEV
EQAQAQIQEIIKDLLVRMDYTEVIIDQRFHRHLIGKNGTNINRIKEQYKVSVRIPQDSER
SNLVRIEGDPKGVQLARRELSEMVQRMENERTKDLIVDQKFHRTIIGQKGEKIKEVRDKF
PEVIINFPDPAQKSDIVQLRGPKNEVEKCAKFLQKIIADLIENSFSLSVPIFKQFHKNII
GKGGANIKKIREETNTKIDLPTENSNSEMIVITGKKGNCEAARERILGIQRELANIKEAE
VVIPARLHNSLIGSKGCLVRSIMDDCGGVHIHFPSEGSGSDRVTIRGPLGEVEKAKKQLL
QLAEEKQVNNFTAELQAKPEYHKFLIGRGGANIRRVRDRTGARIIFPSPDDTEQELITIV
GKEEAVRQAQKELENLVKNLDDVVEDGMEVDVRHHRHFVCRRGQVLRELAEEYGGVAVSF
PRTGVNSQRVTLKGAKECVEAAKKRIQEIIEDLESQVTVEVAIAQRYHRAIMGPKGCRIQ
HITREHEVQIKFPERDDSAAGTTGQDAFLHENGEVGPEEFIPRKCDIITISGRAEKCELA
KAALLALVPITEDVEVSYELHRFIIGQKGSGIRKMMEEYEVNIWVPQPEKQLDVIKVTGL
AANVERAKQGLLERVKELQAEQEDRALRSFKVTMTVDPKFHPKIIGRKGAVISQIRRDHD
VNIQFPDKGDEDQRQDLIVISGYERNVEEARRTIQQLVAELQEMVSQDVHLDPRTHARII
GARGKAIRKLMEEFKVDIRFPPPGSDEPDKVTVMGLPDTVDNAIDHLLNLEEEYMLNLTE
TETLAAYMKPPSRYGGAGGAGGMDDSGGGPAKGFVVRDAPWNTSGNKAPDMSSPEDFPTF
GTGVTLKQASAWGPKK
Download sequence
Identical sequences H2U6U1
ENSTRUP00000032657 31033.ENSTRUP00000032657 ENSTRUP00000032657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]