SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000035893 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000035893
Domain Number 1 Region: 119-624
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.17e-152
Family Calponin-homology domain, CH-domain 0.00000000496
Further Details:      
 
Domain Number 2 Region: 5-93
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000852
Family Calmodulin-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000035893
Sequence length 633
Comment (Takifugu rubripes)
Sequence
MEHHITQISRDDLEDLRDAFNKIDVDNSGYVSDFELRELFKEARLFLPGYKVREIIETFI
AGDTNKDEKISFEEFVSIYQELKSKEYGETFRKTITRRDGIRSFGGTSGNSSEGTQHSYS
DEEKVAFVNWINKALVKDPECQHLLPMNPNDESLFTSVRDGILLCKMINLSQPDTIDERV
INTKKLTTFKMTENLVLALNSASAIGCTVVSMDAHDMMAGKPHLVLGLLWQIIKVGLFAD
IELSRNEGLISLLLDGETLDHLMSLSPEELLLRWVNYHLQNAGTKTIRNFSEDIKDSRAY
FYLLDQIAQYEETAYKSSVRIDMSGLNEEDLERRAELMLRQAARLDCRQFVSPHDVTSGN
SKLNLAFVANLFNMHPAVEKTDLNGMETAHIEGETREEKTYRNWMNSLGVSPHVNHLYCD
LCDGLVILQLLEKVRVPVNWKRVNNPPYPFLGGNMKKLENCNYAVDLGRDIARFSLVGIG
GENLNEGSSMHTLALLWQLMRRYTVLVLSKLGDGEKVADQIILNWVNTTLSQKNKETQIS
SFKDQTISTSLPVIDLIDVIAPGSVKWDMVKKTERGFLKEDDKISNAKYAVSLARKIGAR
VYALPDDLVEVNPKMVLTLFACLMGHGLKKAQP
Download sequence
Identical sequences H2UG23
ENSTRUP00000035893 31033.ENSTRUP00000035893 ENSTRUP00000035893 XP_011613712.1.43653 XP_011613718.1.43653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]