SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000037343 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31033.ENSTRUP00000037343
Domain Number - Region: 294-336
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0338
Family Extended AAA-ATPase domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000037343
Sequence length 341
Comment (Takifugu rubripes)
Sequence
LRMKLLEECLKTSAGPCFVGLVGEKYGSIRVPGEVESAEFEMILDAAVEAGLDTHILEEW
YCRDENSVPPAYYLKPKAQMLKNFQNSMESSSVAKTKNDKAWRNVSEEIKRLFRTAVLQL
QEKGTMKSTEAKKFLCSALEDELDFALGKQTPAFLRKCVCYIRKISNFDRFAKLPEMGRY
MDIVVSADRVMRNQEAYERLLKVRDEFIPTVVAASNLRVYSSVTHCDMKLGYSQEVESNY
VEGLCKQFYEDMVDIIQATVQQNFDTEKDTLYDEILQHLSLCKSHAALHQSKNESLDYIQ
EYLLPSKGSRMSPLVVYGGPCTGKTVLLAEAARQVRDCVSR
Download sequence
Identical sequences H2UK72
ENSTRUP00000037343 ENSTRUP00000037343 31033.ENSTRUP00000037343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]