SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000039364 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000039364
Domain Number 1 Region: 358-522
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-39
Family SPRY domain 0.0024
Further Details:      
 
Domain Number 2 Region: 33-105
Classification Level Classification E-value
Superfamily RING/U-box 8.84e-19
Family RING finger domain, C3HC4 0.0081
Further Details:      
 
Domain Number 3 Region: 163-229
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.22e-16
Family B-box zinc-binding domain 0.0008
Further Details:      
 
Weak hits

Sequence:  31033.ENSTRUP00000039364
Domain Number - Region: 230-301
Classification Level Classification E-value
Superfamily BAG domain 0.011
Family BAG domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000039364
Sequence length 522
Comment (Takifugu rubripes)
Sequence
KFYALCLFYCSGIEVKLSRSLHHRAKMAQKAVELDQESFSCSICLNLLEDPVTIPCGHSY
CMGCIKCYWEEKVIHSCPQCRSAFTPRPTLLKNTMLAVVVEQLKQLGCQAPDGSYAGETD
VACDVCTGVKLKAIKSCLVCLVSYCGKHLQPHYQSATFQKHKLVEPSKTLQENICSHHNE
VMRMFCRTDQQLICYICPVEEHRGHDTVSAAAERTERQKKLIEVQENIQQRLQEREKDFQ
VLEAEVEAVNLSAEKAVEDIDRFFTNLLGILDQRCSDGRQQVRIMQDNEVSQARGLQEKL
QLEITELKKRNDLTDGLSKVQQKLQRILGEDWSNTADTATAITTELSPAPMPQPKSRAEF
LVYSCNLTLDPNSAHTLIVLSDYNRRATYMSYAQQCDSHFKRFLYCCQVLSRERMAGRCY
WEVSRKGRVYVAMSYGSILRGACIKESGFGLNEHSWALLCERGTCTFYHNSVPHAVSGVG
SNRIGVYLDHSAGILSFYSVYQTMTLLHRIQMEFTQPLHAGF
Download sequence
Identical sequences H2UQZ1
ENSTRUP00000039364 31033.ENSTRUP00000039364 ENSTRUP00000039364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]