SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000040723 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000040723
Domain Number 1 Region: 27-188
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.54e-47
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 244-287
Classification Level Classification E-value
Superfamily SOCS box-like 0.000011
Family SOCS box-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000040723
Sequence length 289
Comment (Takifugu rubripes)
Sequence
MSSTMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRKGADVNRMHGTLKPLHCA
CMVADADCVELLLHNGAEVNALDGYNRTALHYAAEKDESCVELLLEYGAQPDALDGNKDT
PLHWAAFKDNPECVKALLENGACPNARDYNNDTPLSWAAMKGNLESVKVLLDYGAQVHVT
NLKGQTPISRLVALLARGLGTEQEEECLDLLCQAAGRFEIRRADGTLPRELNKDPQLLAR
LTSMMAQAPTLRSLARCAVRQSLGVQFLPTAVKDLPLPETIKEYLLLRD
Download sequence
Identical sequences H2UUU8
ENSTRUP00000040723 XP_003963148.1.43653 31033.ENSTRUP00000040723 ENSTRUP00000040723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]