SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000041710 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000041710
Domain Number 1 Region: 29-66,97-385
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.77e-49
Family WD40-repeat 0.00044
Further Details:      
 
Domain Number 2 Region: 391-427
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000102
Family SOCS box-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000041710
Sequence length 428
Comment (Takifugu rubripes)
Sequence
EISDRINDSDSSNPTLLLELKTRRPPSLEGRAGCETWRVDFSPKGDWFAWSMGHGIVWVV
AWPLDSVPATHGAFRSIVHFSIGGRIGDSQNADTDRGDKSFSCGHPVWGLAFGPRPPKSS
GGTPPSRAPTKGSSSLLLATGLENGIIKIWNVLTGEAVFDLHGHEGVVRDLVFPQNGTLT
LISSSRDKTLRIWDLAHKGKRVQVLSGHKDWISCCSVSPDCSMIASVGRFDRMVCLWSLR
SYTFIRNLTGGTRKTLYLLSSCDFSPDGALLATAAFSGSSWWIDLWDPYTAEKLATLIRL
LPCIRSDYFEDYGQNQISSIQFSPDGLYLAIVTDDRALRIWEPGTKGMAMQTRADRQSNG
LCCNYHPQGGVVATGTRDGHVRFWKTPVTLPSLRHLCRSSLRHSVSTHQIQPLPLPKRII
EYLTYRNI
Download sequence
Identical sequences H2UXN1
ENSTRUP00000041710 31033.ENSTRUP00000041710 ENSTRUP00000041710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]