SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000044436 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000044436
Domain Number 1 Region: 102-173
Classification Level Classification E-value
Superfamily RING/U-box 1.88e-18
Family ZZ domain 0.018
Further Details:      
 
Domain Number 2 Region: 368-415
Classification Level Classification E-value
Superfamily UBA-like 4.17e-16
Family UBA domain 0.00025
Further Details:      
 
Domain Number 3 Region: 18-88
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000196
Family PB1 domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000044436
Sequence length 420
Comment (Takifugu rubripes)
Sequence
RMSVTVKAYLLGKDEVVKEVRRFAVDQDVSSSFEYLCRKTAEIFNNLKNSGFNMFYKDED
GDLVAFSSDDELLMGLACMKDSTFRIFIKGTESCRHSCASPWLSEHPMAPPQVLHPNVTC
DGCEGPVVGTRFKCSVCPNYDLCSACQARGMHTEHVLLPIWHPLQWFPRGKWMKWMRHCM
WNQNQSQNQSQSQSQAPDQPPASTPAAESSLPSDSQANVDFLKNIGEGVAAMLSPLGIDV
DIDVEHEGQRAKVVPPLQNERGEEDLGGGANDGGGVKTDCSTSVGTQHMPIKGKGWSDSV
ATQMASVLHMAGQQGNRDSDEEWTHLSPKEVDPSTGELQSLQAQSLPSGGQQHPTGLKEA
ALYPHLPDEADPRLVESLAQMLSMGFTDEGGWLTRLLQAKNYDIGAALDAIQYARQPNPQ
Download sequence
Identical sequences H2V5F2
ENSTRUP00000044436 31033.ENSTRUP00000044436 ENSTRUP00000044436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]