SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000045327 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000045327
Domain Number 1 Region: 424-642
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000975
Family HEAT repeat 0.06
Further Details:      
 
Domain Number 2 Region: 5-153
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000312
Family Galactose-binding domain 0.084
Further Details:      
 
Weak hits

Sequence:  31033.ENSTRUP00000045327
Domain Number - Region: 203-245
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.00732
Family C-terminal UvrC-binding domain of UvrB 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000045327
Sequence length 895
Comment (Takifugu rubripes)
Sequence
MPRKIGFTVVDSSSHEENFSASELMHHAPTVSGWRSSRLCSYPQHITLQLVERSWVRKLQ
LLAHQYLIPTKVEFHIGDTPPDASSPGFPGQLCGLGCVSLCNNENTSFKARELKSGHVDA
FGTYLRITFHRNHVNRYNKYNQVALIAFNVLGETVDGREFNTVPSRGQLIEHDLNSTQLE
ATLDTFMGNYDSISLLDDLAFDMYQDPEVAHIIRVLDQKKQEAVRQENYEEAKNLKQAIA
DLQKVGEMLARYDVEKQCAIEKRDYELAKKKQELMEDYRRRVYQQLEVYNLLDMAMSVLQ
IMTALKSSSGRHPSSLQSSPGHCAAPTKALLSTETLRSSPQGQSSDAGSVAPHSSSLPVS
PCSPSAASHTDVADVPYDERPLPTLQSPAEQHSPLSDTQRSPNGLDMSGEPEPLSEMAQR
QAGLAVEVFGESLVACAYSKTWGYRESAMLNVYKKLLGLSPNTSKEELRNMIRAAVFLVK
RALLDKVSPVFHAALKLLRLLLSQLLSGLGRTEMSRCLEQTWPSLLARTGGPSAHLRAAV
TAFILEIAVLKDVRALHIIPGELVKPFRSSVPPRLAQSRVEMVEKLLAELGTENSGFTLE
NVMTFCTAAMVHSAPVVREVAVRIILLVYRQHGAAVVSYLPPRDAAVRKNFLYKTLFNEF
AKIDGKLVETQVPHQLQRRVVLRKTKRRKKTGWETKAMEKRSRKMRPSLRNIPKKYNTPS
LNTNLTEAAEAKVKGGDFQQSLNHLDKLCIFCGETDESFTDEGLDLHYWTHCPMLRHCDE
CKQVVEIASVTEHLLSECGSRSKFRQCVRCSEAVLAEDLPRHAQGPTCNPPTSGKASSHC
PLCHNNFMPGDEAWKAHLMARGGCKQNSRRPAASQRSLPTQGKAFMAPPLTRSSP
Download sequence
Identical sequences H2V7Y8
ENSTRUP00000045327 ENSTRUP00000045327 31033.ENSTRUP00000045327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]