SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000045958 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000045958
Domain Number 1 Region: 418-497
Classification Level Classification E-value
Superfamily BAG domain 2.75e-25
Family BAG domain 0.0000284
Further Details:      
 
Domain Number 2 Region: 21-59
Classification Level Classification E-value
Superfamily WW domain 0.0000000000204
Family WW domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000045958
Sequence length 497
Comment (Takifugu rubripes)
Sequence
SSSSMNGLKTQPPIVTMANNDNVPLPLGWEVKIDPQTGWPFFVDHNNRTTTWNDPRHDTI
KVREVSANGPNIPPEPSPQETQKTFVREMKHPILRPGYVPIPVFHEGAELRQQQHPCYSY
IQPSTAQNIRTDGRAASPTPGRHCRPRSPLHGPSDSCSPEPGKASSPSPQTSEVYTIPQH
QPPRPSSTGLQAGYISIPVIHEGGGGPTQTQPQTNPAVYSQRVPYSEHQQPFHRIQTDDW
PGYPAAMATPRERASPILIPQHRDSIHLPPHIRSQSPIITQLVGERPQAQHHIITRDLPQ
KPEQEHQSTQQKAEAIPLPRPQHPEADVLKPQQPQQLQQTPPQQPQQFQQAPPQTAQQPH
HPEQSVQSQQQQKPEQPQQHTADITVQIPPKQESLDRTTAPSELPPVKVEAEAAAQCPVH
PGLAKVQQIVERVAKLEQEVKCFEGKKNDKKYLLLEELLTKELLALDSVDPEGRADVRQA
RRDGVRRVQTILEELEQ
Download sequence
Identical sequences H2V9R8
31033.ENSTRUP00000045958 ENSTRUP00000045958 ENSTRUP00000045958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]