SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE04627 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE04627
Domain Number 1 Region: 240-291
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 2 Region: 211-241
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000445
Family Somatomedin B domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE04627
Sequence length 437
Comment (Caenorhabditis remanei)
Sequence
MRQFLFLSLLFAIPYSCRAGCYQRRLCCSGRNNTCKGVDDGISHLPTVSTIHNEEAQTFH
QRPIRVEKEYYSPHYESSGDGYDFIFPDVFDGESDEKIGKLVLPDIIEMEGSGVDKVYQK
YGLGSGDGEPESVKEIPLTTPAPKLKTLIFGQKRDQRTPPEEITRYSEKPKHLLIRYSLL
SKYMPLKVTSTPLLYEENRVQSANNLYYLESSISECYCDEHCVALGDCCSDYTFVCPPRD
CVLTDWDQWSKCSADNGICGIGTQKRLRHVIQNAERGGAACEPLKEMKTCFVECRPTKSA
LDDLTTVALILDYKYNQTRSKFGRNNIYWDLPKIAEKVKKASFYCVHYSIEWVNRNCVSR
LLNKGLAEGSVMCAECQPEATYHRNNGRCASDLEDGDQGFWKLIGPQSCNGIWTRINRTE
HCQCQNKYPDNHPFLLV
Download sequence
Identical sequences E3LYE3
CRE04627 31234.CRE04627 XP_003110782.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]